Align Probable lysine/arginine permease CAN3; Basic amino acids permease CAN3 (characterized)
to candidate Pf1N1B4_5139 Gamma-aminobutyrate permease
Query= SwissProt::A0A1D8PPG4 (566 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5139 Length = 501 Score = 209 bits (531), Expect = 3e-58 Identities = 136/443 (30%), Positives = 218/443 (49%), Gaps = 28/443 (6%) Query: 44 DRITEYDSHGEVKRDLKARHVAMIGIGSTIGTGLFISTGHLLSQTGPVMSLISFLFVTTI 103 + + DS+G++ + K RHV M+ I IG GLF+ +GH ++ GP + L+++LF + Sbjct: 35 NNLNSRDSNGQLAQGFKPRHVTMLSIAGIIGAGLFVGSGHAIAAAGPAV-LLAYLFSGLL 93 Query: 104 CFSVTQSLGEMATYIPVSGSFVQFITRWVSKSCGAANGWLYGWSWAITFGLELSIVGQVI 163 V + LGEMA P +GSF + + + + G GWLY W W + +E G V+ Sbjct: 94 VVLVMRMLGEMAVANPDTGSFSTYADQAIGRWAGFTIGWLYWWFWVLVIPIEALAAGHVL 153 Query: 164 QFWTDAIPLAAWISIFFVLLTALNLFPVKFYGEIEFWMASIKLTAVIGWIIYAFCMVCGA 223 W I + +LL NLF V YGE EFW A K+ A+IG+I F ++ G Sbjct: 154 NQWFPQIDTWLFALTSIILLVVTNLFSVSKYGEFEFWFAMAKVVAIIGFIGLGFAVLMG- 212 Query: 224 GKTGPVGFRYWRNGYAWGDGMIVSNNGKYA----IAFINGLINAVFTFQGTELVAITAGE 279 + A G ++ +G +A A + I +F+F GTE V I A E Sbjct: 213 ---------WIPEREASGLSRLMEEHGGFAPNGLSAVVGAFITIMFSFIGTEAVTIAAAE 263 Query: 280 ASPKA--LKSAIRKVMFRILVFYVLCMLFIGLLVPYNDPKLTEDGGFTRNSPFLIAMENS 337 +S A + A R V++RI VFY+L + + +VP+NDP L G + R A+E Sbjct: 264 SSNPAQNIAKATRSVIWRIGVFYLLSIFVVISVVPWNDPLLASVGSYQR------ALELM 317 Query: 338 GTKVLPHIFNAVIVTTIISAGNSTVYAGSRIFYGLAESGVAPKIFLSTTKAGVPYVAVLF 397 + + V++ + S NS++Y SR+ + L + G APK T+ GVP AV+ Sbjct: 318 NIPHAKLMVDVVVLIAVASCMNSSIYIASRMLFSLGKRGDAPKPLKVTSSDGVPRAAVIA 377 Query: 398 TAAFGALGYLVVSNDGTVVFNWLLNIAATAGLVAWGFISVSHIRFMQVLKQRGISRDTLP 457 + GA L +F +LL + L+ + I+VS +R ++L ++ + TL Sbjct: 378 STVLGAGVTLFSYFMPAGLFQFLLASSGAIALLVYLVIAVSQLRMRKILLRQNV---TLT 434 Query: 458 FKAFFMPYSAYYAAIVVFTVALI 480 FK + P+ + ++ F A + Sbjct: 435 FKMWLFPWLTW--LVIAFICAAL 455 Lambda K H 0.327 0.141 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 745 Number of extensions: 43 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 566 Length of database: 501 Length adjustment: 35 Effective length of query: 531 Effective length of database: 466 Effective search space: 247446 Effective search space used: 247446 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory