GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gtsB in Pseudomonas fluorescens FW300-N1B4

Align ABC transporter for D-Galactose and D-Glucose, permease component 1 (characterized)
to candidate Pf1N1B4_595 Glucose ABC transport system, inner membrane component 1

Query= reanno::pseudo13_GW456_L13:PfGW456L13_1895
         (302 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_595 Glucose ABC transport
           system, inner membrane component 1
          Length = 314

 Score =  595 bits (1534), Expect = e-175
 Identities = 294/302 (97%), Positives = 300/302 (99%)

Query: 1   MSSVAVFSKASPFDALQRWLPKLVLAPSMLIVLVGFYGYIIWTFILSFTNSSFMPSYKWV 60
           MSSVAVFSKASPFDALQRWLPKLVLAPSMLIVLVGFYGYIIWTF+LSFTNSSFMPSYKWV
Sbjct: 13  MSSVAVFSKASPFDALQRWLPKLVLAPSMLIVLVGFYGYIIWTFVLSFTNSSFMPSYKWV 72

Query: 61  GLQQYMRLMDNDRWWVASKNLALFGGMFISISLVLGVFLAVLLDQRIRKEGFIRTVYLYP 120
           GLQQY+RLMDNDRWWVASKNLA+FGGMFI ISLVLGVFLAVLLDQRIRKEGFIRTVYLYP
Sbjct: 73  GLQQYIRLMDNDRWWVASKNLAVFGGMFIGISLVLGVFLAVLLDQRIRKEGFIRTVYLYP 132

Query: 121 MALSMIVTGTAWKWLLNPGLGLDKMLRDWGWEGFRLDWLVDQDRVVYCLVIAAVWQASGF 180
           MALSMIVTGTAWKWLLNPGLGLDKMLRDWGWEGFRLDWLVDQDRVVYCLVIAAVWQASGF
Sbjct: 133 MALSMIVTGTAWKWLLNPGLGLDKMLRDWGWEGFRLDWLVDQDRVVYCLVIAAVWQASGF 192

Query: 181 VMAMFLAGLRGVDQSIIRAAQVDGASLPTIYLKIVLPSLRPVFFSAFMILAHIAIKSFDL 240
           VMAMFLAGLRGVDQSIIRAAQVDGASLPTIYLKIVLPSLRPVFFSAFMILAHIAIKSFDL
Sbjct: 193 VMAMFLAGLRGVDQSIIRAAQVDGASLPTIYLKIVLPSLRPVFFSAFMILAHIAIKSFDL 252

Query: 241 VAAMTAGGPGYSSDLPAMFMYSFTFSRGQMGIGSASAMLMLGAVLTILVPYLYSELRGKR 300
           VAAMTAGGPGYSSDLPAMFMYSFTFSRGQMGIGSASAM+MLGA+L ILVPYLYSELRGKR
Sbjct: 253 VAAMTAGGPGYSSDLPAMFMYSFTFSRGQMGIGSASAMMMLGAILAILVPYLYSELRGKR 312

Query: 301 HD 302
           H+
Sbjct: 313 HE 314


Lambda     K      H
   0.329    0.141    0.448 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 565
Number of extensions: 14
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 302
Length of database: 314
Length adjustment: 27
Effective length of query: 275
Effective length of database: 287
Effective search space:    78925
Effective search space used:    78925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory