Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate Pf1N1B4_5113 Maltose/maltodextrin ABC transporter, permease protein MalF
Query= uniprot:C8WUR0 (321 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5113 Length = 295 Score = 133 bits (335), Expect = 5e-36 Identities = 93/298 (31%), Positives = 155/298 (52%), Gaps = 36/298 (12%) Query: 24 AYGYLSPALVTICVLSILPIFYTIYISFTNFNQMHFLSYQFVGLKNYEELLNPHDPLSNL 83 A+ +L+P L+ + +++ P+ T + S T+ N F+G NY L + S + Sbjct: 4 AWLFLTPMLLCLALVAAWPLLRTFWFSLTDANLADTGGGTFIGFGNY--LFHNGSSWSGI 61 Query: 84 FLPTFIW-----TLVYALCTTALAYLVGLFLAVLLNNKHMRERTLYRTLLIVPWAVPNLI 138 + W TL + + + L ++GL +A+LLN K R L R L+++PWA+P ++ Sbjct: 62 LVDPQWWNAVRNTLYFTVVSVGLEVVLGLLVALLLNIK-FTGRALVRALILIPWAIPTIV 120 Query: 139 SMLAWQGLLNDQYGQINALLH--GVFGLPRIPWLTSALWARIAVIMVNVWAGFPYMMTVC 196 S W +LNDQ+G IN L+ G+ P + W A + AVI+V+VW P++ + Sbjct: 121 SAKIWSWMLNDQFGIINHLMLSLGLIDAP-LAWTADADLSMWAVIIVDVWKTVPFVTLLM 179 Query: 197 LGALQSIPTDQYEAAEIDGANWWQVFRYVTMPSVWRISLPLLIPSFSY--------NFNN 248 L ALQ +P+D YEAA +DG + +VF WR++LPLL+P+ + Sbjct: 180 LAALQMLPSDCYEAARVDGIHPLKVF--------WRVTLPLLMPALLVAAIFRILDSLRV 231 Query: 249 FNASYLLTGGGPPNSNNPFLGQTDILATAAYKMTLTFNRYDLGATISVLLFILVALIS 306 F+ Y+LT NS++ T ++ A + + F G+ S LLF++VA+I+ Sbjct: 232 FDVIYVLTS----NSSS-----TMSMSVYARQHLVEFQDVGYGSAASTLLFLVVAVIA 280 Lambda K H 0.327 0.140 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 295 Length adjustment: 27 Effective length of query: 294 Effective length of database: 268 Effective search space: 78792 Effective search space used: 78792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory