Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate Pf1N1B4_5114 Maltose/maltodextrin ABC transporter, permease protein MalG
Query= uniprot:C8WUQ9 (301 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5114 Length = 280 Score = 147 bits (370), Expect = 4e-40 Identities = 85/270 (31%), Positives = 143/270 (52%), Gaps = 8/270 (2%) Query: 39 RIVIWCVIVMVLL----PMWFVVIASFNPSNSYISFSLFPSNASLANYKALFQGGQFWTW 94 R+ WC+I ++LL P ++ ++ S PS++ S + N +NY A+ F Sbjct: 12 RLGFWCLIGVLLLYAVFPFYYAIVTSLKPSSALFEVSYWIENPDFSNYAAVLNQASFLRA 71 Query: 95 VRNSLVVGVVVAMAQSFITAMSAFAFSKLRFYGRKYGLMTLLLLQMFPNILAIAAFYTAL 154 + NSLVV + V F++ +A+A +++F GR LM +L + MFP + ++ + + Sbjct: 72 IGNSLVVALCVVTLALFLSLTAAYALGRVKFRGRGTVLMMVLGVSMFPQVAVLSGLFEVI 131 Query: 155 AKLNMIDMLGSYIL-VMLGTSAFNIWLLKGYMDSVPKELDEAAVIDGATTWQRFIHVTLP 213 L + + + IL + T F +W+L +M +P EL+EAA++DGA+ W V LP Sbjct: 132 RALGLYNTSWALILSYTIFTLPFTVWVLTTFMGQLPHELEEAAIMDGASPWVTLTRVLLP 191 Query: 214 LSTPMMVVIFFLTLVGIFSEYMFAGTILQSPWNYTLGVGMYNLISGQFAKN--WGEFAAA 271 L P +V L + ++E++FA T + T+ V + LISG WG AA Sbjct: 192 LLWPALVTTGLLAFIAAWNEFLFALTFTLTDTQRTVPVAI-ALISGGSPHELPWGLLMAA 250 Query: 272 ALLSAVPLAIVFAVAQRYLTKGLVAGSVKG 301 +++ VPL I+ + QR + GL AG++KG Sbjct: 251 SVVVTVPLVILVLIFQRRIVSGLTAGALKG 280 Lambda K H 0.328 0.136 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 280 Length adjustment: 26 Effective length of query: 275 Effective length of database: 254 Effective search space: 69850 Effective search space used: 69850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory