GapMind for catabolism of small carbon sources

 

Aligments for a candidate for malK_Ss in Pseudomonas fluorescens FW300-N1B4

Align MalK, component of Maltose and maltooligosaccharide porter (characterized)
to candidate Pf1N1B4_1127 Dipeptide transport ATP-binding protein DppF (TC 3.A.1.5.2)

Query= TCDB::Q97UG5
         (617 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1127 Dipeptide transport
           ATP-binding protein DppF (TC 3.A.1.5.2)
          Length = 326

 Score =  191 bits (484), Expect = 5e-53
 Identities = 106/267 (39%), Positives = 168/267 (62%), Gaps = 9/267 (3%)

Query: 355 VVMKILNLSKIYYIRKNLILSEP-INAVNDVSFELKKGTITALVGGSGHGKSTIAKILAG 413
           VV+   NL++ Y + + L      + A+N VSFEL+ G   A+VG SG GKST+A+ L  
Sbjct: 3   VVLTARNLTRHYEVSRGLFKGHATVRALNGVSFELEAGKTLAVVGESGCGKSTLARALTL 62

Query: 414 MIQQTSGKIILLGKDVSEYGVRNSMWYKENVQMIFQDPYSSLDPRHTVRWHVERPLLIHK 473
           + + +SG + + G++V+          +++VQM+FQ PY+SL+PR  V   +  PLLI+ 
Sbjct: 63  IEEPSSGSLKIAGQEVAGADKAQRKQLRKDVQMVFQSPYASLNPRQKVGDQLAEPLLINT 122

Query: 474 KVSNKDQLLPKIIEVLKNVGLKPPEKYLYKYPHELSGGERQRVAIARATAVEPKVLVADE 533
            +S  ++   K+  ++K VGL+P  ++  +YPH  SGG+RQR+A+ARA  ++PKVLVADE
Sbjct: 123 NLSASER-REKVQAMMKQVGLRP--EHYQRYPHMFSGGQRQRIALARAMMLQPKVLVADE 179

Query: 534 PVSMLDASLRAGILNLIKKFKKN-GISILYITHDIATVNYIADEIMVIYKGRIVEKGNTY 592
           P S LD S++A +LNL    ++    + ++I+H++A V ++AD +MV+Y GR VE G   
Sbjct: 180 PTSALDVSIQAQVLNLFMDLQQEFNTAYVFISHNLAVVRHVADHVMVMYLGRPVEMGPKE 239

Query: 593 EVISNPSHEYTKRLIEAV----PDPYK 615
           ++ + P H YT+ L+ A     PDP K
Sbjct: 240 DIYTRPLHPYTQALLSATPTIHPDPTK 266



 Score =  176 bits (447), Expect = 1e-48
 Identities = 102/314 (32%), Positives = 178/314 (56%), Gaps = 9/314 (2%)

Query: 7   SLLKVNELTAGYFNQDGFVIGVTNVNFEVYPNEIFAIAGESGCGKSTLAMAIYGLLKYPG 66
           +L +  E++ G F     V  +  V+FE+   +  A+ GESGCGKSTLA A+  L++ P 
Sbjct: 9   NLTRHYEVSRGLFKGHATVRALNGVSFELEAGKTLAVVGESGCGKSTLARALT-LIEEPS 67

Query: 67  VVLRGHVYLKDKDILSITQEELRKLRMKEFVYVPQFAMDALDPVAKIGDQMMRAA-VSHG 125
               G + +  +++    + + ++LR K+   V Q    +L+P  K+GDQ+     ++  
Sbjct: 68  ---SGSLKIAGQEVAGADKAQRKQLR-KDVQMVFQSPYASLNPRQKVGDQLAEPLLINTN 123

Query: 126 VNVEEARKLIKEKLELVDLPYNVVNMYPHELSGGMRQRVVIATSILLNPSLIILDEPTTG 185
           ++  E R+ ++  ++ V L       YPH  SGG RQR+ +A +++L P +++ DEPT+ 
Sbjct: 124 LSASERREKVQAMMKQVGLRPEHYQRYPHMFSGGQRQRIALARAMMLQPKVLVADEPTSA 183

Query: 186 LDVIVQYEILKDLKRIQRQLGVSLVIISHDISMLLMISDRVGIMYAGEIVEIGSKEEIIK 245
           LDV +Q ++L     +Q++   + V ISH+++++  ++D V +MY G  VE+G KE+I  
Sbjct: 184 LDVSIQAQVLNLFMDLQQEFNTAYVFISHNLAVVRHVADHVMVMYLGRPVEMGPKEDIYT 243

Query: 246 RPSHPYTYLLISSLPSLVKRREK-LLSIPGNPPLMLSKVPNSCRFYDRCPFKMEKCSTLN 304
           RP HPYT  L+S+ P++     K  + I G  P  L+  P+ C F+ RCP+  ++C+T  
Sbjct: 244 RPLHPYTQALLSATPTIHPDPTKPKIKIVGELPNPLNP-PSGCAFHKRCPYATDRCTTEE 302

Query: 305 PALGDIMDGHKARC 318
           P L  ++D  +  C
Sbjct: 303 PLL-RLVDTRQVAC 315


Lambda     K      H
   0.319    0.138    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 502
Number of extensions: 22
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 617
Length of database: 326
Length adjustment: 33
Effective length of query: 584
Effective length of database: 293
Effective search space:   171112
Effective search space used:   171112
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory