Align beta-Phosphoglucomutase (EC 5.4.2.6) (characterized)
to candidate Pf1N1B4_3808 hydrolase, haloacid dehalogenase-like family
Query= BRENDA::P71447 (221 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3808 Length = 231 Score = 86.3 bits (212), Expect = 4e-22 Identities = 63/192 (32%), Positives = 96/192 (50%), Gaps = 14/192 (7%) Query: 3 KAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADK 62 KAV+FD+DG++ DT + +A G D + + G D + +++ D Sbjct: 12 KAVIFDMDGLLLDTEGIYTEVTSIIAGRYG-RTFDWSVKQNIIGRGAGDLARYVVEALDL 70 Query: 63 KVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFL 122 ++AEEF + + M + A PG +L++ L++N I IA+ ++S F Sbjct: 71 PITAEEFLVIREPL------MRERFPTALAMPGAEELVRHLKANNIPIAVGTSSSRQSFG 124 Query: 123 LEKMNLT----GYFDAI--ADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQ 176 EK L FD I AD EV A+KPAPDIF+ AA +GVAP + + EDS G+ Sbjct: 125 -EKTTLHREWFALFDFIVTADDPEVGAAKPAPDIFLTAARRLGVAPGDCLVFEDSPFGVT 183 Query: 177 AIKDSGALPIGV 188 A K +G I + Sbjct: 184 AAKAAGMTAIAI 195 Lambda K H 0.316 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 221 Length of database: 231 Length adjustment: 22 Effective length of query: 199 Effective length of database: 209 Effective search space: 41591 Effective search space used: 41591 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory