Align mannitol 2-dehydrogenase (EC 1.1.1.67) (characterized)
to candidate Pf1N1B4_4176 Alcohol dehydrogenase (EC 1.1.1.1)
Query= BRENDA::Q8KQG6 (338 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4176 Length = 327 Score = 80.1 bits (196), Expect = 7e-20 Identities = 58/166 (34%), Positives = 83/166 (50%), Gaps = 10/166 (6%) Query: 25 NEVLIHTAFAGICGTD-HALYAGLPGSADAVPPIVLGHENSGVVAEIGSAVTNVKVGDRV 83 +++LI G+C TD H + LP AV P V GHE G V +G+ V VG RV Sbjct: 26 HQLLIKVLACGVCRTDLHLVDGELP---QAVLPRVPGHEIVGEVTAVGANVAPDWVGKRV 82 Query: 84 TVD-PNIYCGQCKYCRTARPELCENLSAVGVTRDGGFEEFFTAPASVVYPIPDNVSLKSA 142 V CG+C +CR+ R LC+ G DGG+ E+ A A +PIPD +S A Sbjct: 83 GVPWLGWTCGECTFCRSGRENLCDRARFTGCHLDGGYAEYTVADAHFCFPIPDALSAAEA 142 Query: 143 AVVEPISCA-VHGIQLLKVTPYQKAL-VIGDGFMGELFVQILQAYG 186 A P+ CA + G + L++ + L + G G L +Q+ + G Sbjct: 143 A---PLLCAGLIGFRALQMAKGARHLGLYGFGAAAHLAIQVARGRG 185 Lambda K H 0.317 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 327 Length adjustment: 28 Effective length of query: 310 Effective length of database: 299 Effective search space: 92690 Effective search space used: 92690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory