Align ABC transporter for D-mannitol and D-mannose, ATPase component (characterized)
to candidate Pf1N1B4_691 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
Query= reanno::pseudo3_N2E3:AO353_25895 (367 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_691 Length = 351 Score = 251 bits (642), Expect = 2e-71 Identities = 155/369 (42%), Positives = 220/369 (59%), Gaps = 33/369 (8%) Query: 1 MAHLKIKNLQKGFEGFSIIKGIDLEVNDREFVVFVGPSGCGKSTLLRLIAGLEEVTAGTI 60 M L ++N++K + +K ++L + + + V F+GPSGCGK+TLLR+IAGLE +T G I Sbjct: 1 MTGLILENVEKHYGSACAVKDVNLHLPEGKLVCFLGPSGCGKTTLLRMIAGLETLTGGEI 60 Query: 61 ELDGRDITEVSPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVNKAEVEKKVNEAARI 120 LDG DI +R+ MVFQ+ AL+PHM+V +N+++ L L GV+KA+ + +V E + Sbjct: 61 RLDGEDIGHTPAHQRNFGMVFQSLALFPHMTVGENIAYPLKLRGVSKADQQARVVELLEL 120 Query: 121 LELGPMLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARLH 180 ++L M++R +LSGGQRQRVAI RAI PKI L DEPLS LDA LR M++E+ +L Sbjct: 121 IQLQEMIDRPVAKLSGGQRQRVAIARAIASRPKILLLDEPLSALDAKLRESMQVEIRQLQ 180 Query: 181 KELQATMIYVTHDQVEAMTLADKVVVLNGGRIEQVGSPLELYHQPANLFVAGFLGT---- 236 + L T I VTHDQ EAMT+AD VVVL R++QVGSP+E+Y PAN FVA F+G+ Sbjct: 181 QRLNITTIMVTHDQREAMTMADIVVVLGEHRVQQVGSPIEIYRHPANEFVADFIGSGNIF 240 Query: 237 PKMGFLKGKVTRVERQNCEVLLDAGTRITLPLSGANLSIGGAVTLGIRPEHLNLALPGDC 296 P GKV+ L G + +P+ +++ +G V + IRPE L L+ P Sbjct: 241 PATALGNGKVS----------LPGGDALQVPIC-SSIVVGEKVKMLIRPEDLQLSQP--- 286 Query: 297 TLQVTADVSERLGSDTFCHVLTASGE-----------ALTMRIRGDLASRYGEQLSLHLD 345 Q TA + LG TF + A+ E AL+ +G + G +S+ L Sbjct: 287 --QATAG-NRLLGKVTFVRDIGATIETTVECSGVSFTALSTPCQG-VGLSIGNPVSVTLP 342 Query: 346 AEHCHLFDA 354 AE C + A Sbjct: 343 AEACRVLSA 351 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 351 Length adjustment: 29 Effective length of query: 338 Effective length of database: 322 Effective search space: 108836 Effective search space used: 108836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory