GapMind for catabolism of small carbon sources

 

Aligments for a candidate for HSERO_RS03640 in Pseudomonas fluorescens FW300-N1B4

Align Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale)
to candidate Pf1N1B4_1243 ABC transporter ATP-binding protein

Query= uniprot:D8IZC7
         (521 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1243 ABC transporter
           ATP-binding protein
          Length = 521

 Score =  286 bits (732), Expect = 1e-81
 Identities = 178/491 (36%), Positives = 271/491 (55%), Gaps = 24/491 (4%)

Query: 3   QTPLLQMRGIRKSFGATLALSDMHLTIRPGEIHALMGENGAGKSTLMKVLSGVHAPDQGE 62
           Q P LQ+R I K +   LA   + L+I PGEIHAL+GENGAGKSTLMK++ GV   D GE
Sbjct: 10  QIPRLQLRRISKRYPGCLANDAIDLSIAPGEIHALLGENGAGKSTLMKIIYGVTHADSGE 69

Query: 63  ILLDGRPVALRDPGASRAAGINLIYQELAVAPNISVAANV--FMGSELRTRLGLIDHAAM 120
           ++  G+ V +R+P  +R  GI +++Q  ++   +SVA N+   MG+   T         +
Sbjct: 70  MIWQGQRVTMRNPAQARGLGIGMVFQHFSLFETLSVAQNIALAMGAAAGT------PKQL 123

Query: 121 RSRTDAVLRQLGAGFGASDLAGRLSIAEQQQVEIARALVHRSRIVIMDEPTAALSERETE 180
             +   V ++ G       L   LSI E+Q+VEI R L+   R++I+DEPT+ L+ +E +
Sbjct: 124 EPKIREVSQRYGMALEPERLVHSLSIGERQRVEIIRCLMQDIRLLILDEPTSVLTPQEAD 183

Query: 181 QLFNVVRRLRDEGLAIIYISHRMAEVYALADRVTVLRDGSFVGELVRDEIDSERIVQMMV 240
           +LF  +RRL  EG +I++ISH++ EV AL    TVLR G   G  V  +    ++ Q+MV
Sbjct: 184 ELFVTLRRLAAEGCSILFISHKLGEVRALCHSATVLRGGRVAGHCVPAQCSDRQLAQLMV 243

Query: 241 GRSLSEFYQHQRIAPADAAQLPTVMQVRALA-------GGKIRPASFDVRAGEVLGFAGL 293
           G +      + ++  ADA      + V  L+       G  ++   FDVR+GE++G AG+
Sbjct: 244 GEAAELITDYPKVMGADA-----FLSVTGLSWHNPDPFGCSLKNIDFDVRSGEIVGVAGV 298

Query: 294 VGAGRTELARLLFGAD--PR-SGGDILLEGRPVHIDQPRAAMRAGIAYVPEDRKGQGLFL 350
            G G+ EL  LL G +  PR     I   G+PV   +P A  + G+A+VP +R G G   
Sbjct: 299 AGNGQDELLALLSGEERLPRDDSATISFGGQPVAHLRPDARRKLGLAFVPAERLGHGAVP 358

Query: 351 QMAVAANATMNVASRH-TRLGLVRSRSLGGVARAAIQRLNVKVAHPETPVGKLSGGNQQK 409
           ++++A NA +    +     GLV+   +  +A   I+R  VK      P   LSGGN QK
Sbjct: 359 ELSLADNALLTAFQQGLVSHGLVQRGKVQALAEDIIRRFGVKTPDSLAPARSLSGGNLQK 418

Query: 410 VLLARWLEIAPKVLILDEPTRGVDIYAKSEIYQLVHRLASQGVAVVVISSELPEVIGICD 469
            +L R +   PK+L+   PT GVD+ A + I++ +  L   G A++VIS +L E+  ICD
Sbjct: 419 FILGREILQQPKLLVAAHPTWGVDVGAAATIHRALIALRDAGAAILVISEDLDELFQICD 478

Query: 470 RVLVMREGMIT 480
           R+  +  G ++
Sbjct: 479 RLGALCGGQLS 489



 Score = 81.3 bits (199), Expect = 8e-20
 Identities = 59/215 (27%), Positives = 103/215 (47%), Gaps = 9/215 (4%)

Query: 282 VRAGEVLGFAGLVGAGRTELARLLFGADPRSGGDILLEGRPVHIDQPRAAMRAGIAYVPE 341
           +  GE+    G  GAG++ L ++++G      G+++ +G+ V +  P  A   GI  V +
Sbjct: 36  IAPGEIHALLGENGAGKSTLMKIIYGVTHADSGEMIWQGQRVTMRNPAQARGLGIGMVFQ 95

Query: 342 DRKGQGLFLQMAVAANATMNVASRHTRLGLVRSRSLGGVARAAIQRLNVKVAHPETPVGK 401
                 LF  ++VA N  + + +          + L    R   QR  + +  PE  V  
Sbjct: 96  HFS---LFETLSVAQNIALAMGA-----AAGTPKQLEPKIREVSQRYGMAL-EPERLVHS 146

Query: 402 LSGGNQQKVLLARWLEIAPKVLILDEPTRGVDIYAKSEIYQLVHRLASQGVAVVVISSEL 461
           LS G +Q+V + R L    ++LILDEPT  +      E++  + RLA++G +++ IS +L
Sbjct: 147 LSIGERQRVEIIRCLMQDIRLLILDEPTSVLTPQEADELFVTLRRLAAEGCSILFISHKL 206

Query: 462 PEVIGICDRVLVMREGMITGELAGAAITQENIMRL 496
            EV  +C    V+R G + G    A  +   + +L
Sbjct: 207 GEVRALCHSATVLRGGRVAGHCVPAQCSDRQLAQL 241


Lambda     K      H
   0.320    0.135    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 733
Number of extensions: 50
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 521
Length of database: 521
Length adjustment: 35
Effective length of query: 486
Effective length of database: 486
Effective search space:   236196
Effective search space used:   236196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory