GapMind for catabolism of small carbon sources

 

Aligments for a candidate for HSERO_RS03645 in Pseudomonas fluorescens FW300-N1B4

Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate Pf1N1B4_6033 Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)

Query= uniprot:D8IZC8
         (344 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6033 Ribose ABC transport
           system, permease protein RbsC (TC 3.A.1.2.1)
          Length = 325

 Score =  184 bits (468), Expect = 2e-51
 Identities = 116/314 (36%), Positives = 171/314 (54%), Gaps = 20/314 (6%)

Query: 45  FYGLTLYLSGDG------------TSNFASAENTMNILRQVAINLVLAAGMTFVILTAGI 92
           FYGL  YL   G            +S+F S +    +  Q+   +VLA GMTFV++  GI
Sbjct: 14  FYGLGTYLGLAGALLAMVALFSVLSSHFLSYDTFSTLANQIPDLMVLAVGMTFVLIIGGI 73

Query: 93  DLSVGSVLAVSAVLGMQVSLGAAPGWAIPMFIFSGLVM----GMVNGAMVALLNINAFVV 148
           DLSVGSVLA++A       LG   GW++      G+ +    G + G++     I +F+V
Sbjct: 74  DLSVGSVLALAASAVSVAILGW--GWSVLPAALLGMAVAALAGTITGSITVAWRIPSFIV 131

Query: 149 TLGTMTAFRGAAYLLADGTTVLNNDIPSFEWIGNGDFLHVPWLIWVAVAVVLLSWVILRK 208
           +LG +   RG AY +    T    D  +F W+ N     +     +A+ ++ ++  +L +
Sbjct: 132 SLGVLEMARGLAYQMTGSRTAYIGD--AFAWLSNPIAFGISPSFIIALLIIFIAQAVLTR 189

Query: 209 TVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYSISGLFSGLAGAMSASRLYGANGNWGSG 268
           TV G ++  IG N +A RL GI      + V+S+ GL +G+A     SRL  A+ N GSG
Sbjct: 190 TVFGRYLIGIGTNEEAVRLAGINPKPYKILVFSLMGLLAGIAALFQISRLEAADPNAGSG 249

Query: 269 YELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIGVMNNGLTILGLSSFWQYVAKGAVIVL 328
            EL  IAAVV+GGTSLMGG GS+  T  G LII V+  GL  +G +   + +  GAVIV+
Sbjct: 250 LELQVIAAVVIGGTSLMGGRGSVISTFFGVLIISVLAAGLAQIGATEPTKRIITGAVIVV 309

Query: 329 AVILDKWRQKDAAQ 342
           AV+LD +R + A++
Sbjct: 310 AVVLDTYRSQRASR 323


Lambda     K      H
   0.324    0.138    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 289
Number of extensions: 15
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 344
Length of database: 325
Length adjustment: 28
Effective length of query: 316
Effective length of database: 297
Effective search space:    93852
Effective search space used:    93852
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory