Align TM1748, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate Pf1N1B4_5103 Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)
Query= TCDB::Q9X270 (289 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5103 Length = 284 Score = 154 bits (388), Expect = 3e-42 Identities = 90/272 (33%), Positives = 150/272 (55%), Gaps = 5/272 (1%) Query: 18 LRFKKNKMAVIGGVFVLI-LIALAILAPYIAPY-PYDEPHYIRAFEGPSKDFIFGTDALG 75 L + ++A+ G+ +L + LAI AP+IAP+ P + IR P FGTD G Sbjct: 15 LGLRNPRLAMGLGLTILFGWLVLAIFAPWIAPFDPIAQNTDIRLV-APHLAHPFGTDNFG 73 Query: 76 RDLFSRILYSLRNACIIGFGSQFVVLIIGGILGAVAGFKGGWIDKFIMSIVDIMFAFPTF 135 RD+ SR+++S R + +IG +GA++G+ GG D F M ++DI+ AFP Sbjct: 74 RDVLSRVIWSARIDLQLAVIGVIFPFLIGTCVGALSGYIGGRFDTFCMRLIDIILAFPFL 133 Query: 136 LFNVILVTALGRGLFTIFLAIGLTGWAGMARLVRGQVLYLKNSEFVEAAKAAGASTFYII 195 + + ++ LG GL + ++A+ L GW ARL+R Q+L LK S+F AAK+ G I+ Sbjct: 134 VLMLAIMAILGPGLMSFYIAMALVGWVSYARLIRSQILILKESDFALAAKSLGFGHGRIL 193 Query: 196 RKHILPN-MIGPILVNLAFGVPGAMMTESGLAVIGMGVRPPMPSWGNLIGEGIGMMMAFP 254 +H+LPN M G I+ +++ V ++ + ++ +G+GV+PP WG ++ EG + + Sbjct: 194 FRHLLPNAMFGSIVFSMSDAVL-VLLNGAAVSYLGLGVQPPTAEWGTMVAEGQSFITSAW 252 Query: 255 HLLIFPAVTFAFTLISFTFLADGLRDAFNPRS 286 + FP + + F+ LAD + + RS Sbjct: 253 WICTFPGLAIVTLAMGFSLLADAVAEHLGERS 284 Lambda K H 0.331 0.147 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 284 Length adjustment: 26 Effective length of query: 263 Effective length of database: 258 Effective search space: 67854 Effective search space used: 67854 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory