Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate Pf1N1B4_5105 Peptide ABC transporter, ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5105 Length = 323 Score = 250 bits (639), Expect = 3e-71 Identities = 130/288 (45%), Positives = 190/288 (65%), Gaps = 1/288 (0%) Query: 30 LKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGGKIFFEGKDITNLNDKEM 89 L AV+G+S+ + GETLGLVGESG GKS+LGR IL L G++ F+G D+ + ++ Sbjct: 28 LTAVNGVSLTLSAGETLGLVGESGSGKSSLGRAILHLNEIYAGQVLFDGIDMAHAGKVDI 87 Query: 90 KPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIGTKKERRKRVEELLDMVGIGREF 149 R + ++FQDP +LNP++++G+ + + L + + + RV ELL +VG+ E Sbjct: 88 TRLRHETAMVFQDPYAALNPRLSIGQTLAEVLRVQRKVPESLIAARVGELLTLVGLRPEL 147 Query: 150 INSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALDVSIQAQIIDLLEEIQQKMGIS 209 + PH SGGQ QR+GIARALA+ P+ IV DE V+ALDVSIQ QII+LL E++Q+M ++ Sbjct: 148 ASRKPHALSGGQCQRVGIARALAVEPRLIVADECVAALDVSIQGQIINLLLELRQRMNLA 207 Query: 210 YLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFLNPIHPYTRALLKSVPKIPWDGQK 269 +FIAH+LA+V + +VAVMYLGKIVE G V+++F +P HPYT AL++S+P+I + Sbjct: 208 IVFIAHDLAIVRRLCDRVAVMYLGKIVEEGPVEEVFRSPRHPYTAALIQSIPEID-PARA 266 Query: 270 QRFYSLKGELPSPIDLPKGCRFQTRCTEKKAICFEKEPELTEVEKNHF 317 L GE PSP+ LP GC F RC +A C + P +++ + Sbjct: 267 LPTDPLPGEPPSPLQLPSGCAFHPRCRYVRATCSQVVPPTRQLDARRY 314 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 323 Length adjustment: 28 Effective length of query: 300 Effective length of database: 295 Effective search space: 88500 Effective search space used: 88500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory