Align m-Inositol ABC transporter, permease component (iatP) (characterized)
to candidate Pf1N1B4_409 L-arabinose transport system permease protein (TC 3.A.1.2.2)
Query= reanno::pseudo3_N2E3:AO353_21390 (340 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_409 Length = 322 Score = 175 bits (444), Expect = 1e-48 Identities = 108/338 (31%), Positives = 182/338 (53%), Gaps = 25/338 (7%) Query: 5 LENKPAMAPAK--SRRRLPTELSIFLVLIGIGLVFEMFGWIVRDQSFLMNSQRLVLMILQ 62 ++NK P K RR + + L +GI F + ++ + +N + L L I Sbjct: 3 VQNKALPTPRKPLDLRRFLDDWVMLLAAVGI---FVLCTLLIDNFLSPLNMRGLGLAI-- 57 Query: 63 VSIIGLLAIGVTQVIITTGIDLSSGSVLALSAMIAASLAQTSDFARAVFPSLTDLPVWIP 122 S G+ A + + + DLS GSV+A + ++AA + + +D V++ Sbjct: 58 -STTGIAACTMLYCLASGHFDLSVGSVIACAGVVAAVVMRDTD------------SVFLG 104 Query: 123 VIAGLGVGLLAGAINGSIIAVTGIPPFIATLGMMVSARGLARYYTEGQPVSMLSDSYTAI 182 V A L +GL+ G ING +IA + I TL M RGLA + G+ V + + + Sbjct: 105 VSAALVMGLIVGLINGIVIAKLRVNALITTLATMQIVRGLAYIFANGKAVGVSQEQFFVF 164 Query: 183 GHGAM-----PVIIFLVVAVIFHIALRYTKYGKYTYAIGGNMQAARTSGINVKRHLVIVY 237 G+G + P++I +V + F L YT YG+ T AIGGN +AA +G+NV R +++ Sbjct: 165 GNGQLFGVPVPILITIVCFLFFGWLLNYTTYGRNTMAIGGNQEAALLAGVNVDRTKTLIF 224 Query: 238 SIAGLLAGLAGVVASARAATGQAGMGMSYELDAIAAAVIGGTSLAGGVGRITGTVIGALI 297 ++ G++ LAGV+ ++R +GQ +G +EL I+A V+GG SL+GG+G I + G LI Sbjct: 225 AVHGVIGALAGVILASRMTSGQPMIGQGFELTVISACVLGGVSLSGGIGMIRHVIAGVLI 284 Query: 298 LGVMASGFTFVGVDAYIQDIIKGLIIVIAVVIDQYRNK 335 L ++ + +D + Q +I+G I+++AVVID+ + + Sbjct: 285 LAIIENAMNLKNIDTFYQYVIRGSILLLAVVIDRLKQR 322 Lambda K H 0.326 0.140 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 322 Length adjustment: 28 Effective length of query: 312 Effective length of database: 294 Effective search space: 91728 Effective search space used: 91728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory