Align 1,2-phenylacetyl-CoA epoxidase, subunit E; 1,2-phenylacetyl-CoA epoxidase, reductase subunit; 1,2-phenylacetyl-CoA monooxygenase, subunit E; EC 1.-.-.- (characterized)
to candidate Pf1N1B4_925 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17)
Query= SwissProt::P76081 (356 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_925 Length = 393 Score = 85.1 bits (209), Expect = 3e-21 Identities = 69/238 (28%), Positives = 108/238 (45%), Gaps = 10/238 (4%) Query: 7 LTVAKVESETRDAVTITFAVPQPLQEAYRFRPGQHLTLKASFDGEELRRCYSICRSYLPG 66 + VAKVE E+ + ++ F P PGQ++ +K DGEE+RR YS+ G Sbjct: 159 IVVAKVE-ESAEIISFYFE-PADKGPILAAEPGQYIGMKLILDGEEIRRNYSLSALANKG 216 Query: 67 EISVAVKAIEGGRFSRYAREHIRQGMTLEVMVPQGHFGYQPQAERQGRYLAIAAGSGITP 126 + ++VK GGR S + + + G ++ + P G F + + I+ G GITP Sbjct: 217 QYRISVKRETGGRASNHLHDQLHVGASILLFPPAGDFTLTASDK---PLVLISGGVGITP 273 Query: 127 MLAIIATTLQTEPESQFTLIYGNRTSQSMMFRQALADLKDKYPQRLQLLCIFSQETLDSD 186 LA++ L TE F I+ R FR + L +++PQ + C + + Sbjct: 274 TLAMLEAALATERPVHF--IHCARNGSVHAFRDWIDGLAERHPQLKRFYCYAEDDGISP- 330 Query: 187 LLHGRIDGEKLQSLGASLINFRLYDEAFICGPAAMMDDAETALKALGMPDKTIHLERF 244 ++ + LG L R D A+ GP M + LKALG+P+K E F Sbjct: 331 -AADKVGLLSQEQLGEWLPEQRDVD-AYFLGPKGFMAAIKRHLKALGVPEKQSRYEFF 386 Lambda K H 0.320 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 393 Length adjustment: 30 Effective length of query: 326 Effective length of database: 363 Effective search space: 118338 Effective search space used: 118338 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory