GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PAH in Pseudomonas fluorescens FW300-N1B4

Align Phenylalanine 4-monooxygenase (EC 1.14.16.1) (characterized)
to candidate Pf1N1B4_3566 Phenylalanine-4-hydroxylase (EC 1.14.16.1)

Query= reanno::pseudo13_GW456_L13:PfGW456L13_4394
         (261 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3566
           Phenylalanine-4-hydroxylase (EC 1.14.16.1)
          Length = 261

 Score =  523 bits (1346), Expect = e-153
 Identities = 250/261 (95%), Positives = 255/261 (97%)

Query: 1   MKQTQYVAREPDAQGFIDYPAEEHAVWNTLITRQLKVIEGRACQEYLDGIEKLGLPHDRI 60
           MKQTQYVAREPDAQGFIDYPAEEHAVWNTLITRQLKV+EGRACQEYLDGIEKLGLPHDRI
Sbjct: 1   MKQTQYVAREPDAQGFIDYPAEEHAVWNTLITRQLKVVEGRACQEYLDGIEKLGLPHDRI 60

Query: 61  PQLGEINKVLAETTGWQVARVPALIPFQTFFELLASKQFPVATFIRTREELDYLQEPDIF 120
           PQLGEINKVL ETTGWQVARVPALIPFQTFFELLA+KQFPVATFIRTREELDYLQEPDIF
Sbjct: 61  PQLGEINKVLGETTGWQVARVPALIPFQTFFELLANKQFPVATFIRTREELDYLQEPDIF 120

Query: 121 HEIFGHCPLLTNPWFAEFTHTYGKLGLKASKEERVYLARLYWMTIEFGLLDTPQGQRIYG 180
           HEIFGHCPLLTNPWFAEFTHTYGKLGL+ASKEERVYLARLYWMTIEFGL+DTPQG RIYG
Sbjct: 121 HEIFGHCPLLTNPWFAEFTHTYGKLGLQASKEERVYLARLYWMTIEFGLVDTPQGLRIYG 180

Query: 181 GGILSSPKETVYSLSNEPEHQAFDPLECMRTPYRIDILQPLYFVLPNLKRLFDLAHEDIM 240
           GGILSSPKETVY LSNEPEHQAFDPLECMRTPYRIDILQPLYFVLPNLKRLFDLAHEDIM
Sbjct: 181 GGILSSPKETVYCLSNEPEHQAFDPLECMRTPYRIDILQPLYFVLPNLKRLFDLAHEDIM 240

Query: 241 GMVKQAMQMGLHTPKFPPKAA 261
           GMVKQ MQ+GL  PKFPPKAA
Sbjct: 241 GMVKQGMQLGLRAPKFPPKAA 261


Lambda     K      H
   0.322    0.140    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 410
Number of extensions: 9
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 261
Length of database: 261
Length adjustment: 25
Effective length of query: 236
Effective length of database: 236
Effective search space:    55696
Effective search space used:    55696
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)

Align candidate Pf1N1B4_3566 (Phenylalanine-4-hydroxylase (EC 1.14.16.1))
to HMM TIGR01267 (phhA: phenylalanine-4-hydroxylase (EC 1.14.16.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01267.hmm
# target sequence database:        /tmp/gapView.13770.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01267  [M=248]
Accession:   TIGR01267
Description: Phe4hydrox_mono: phenylalanine-4-hydroxylase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
   2.1e-130  419.3   0.0   2.4e-130  419.1   0.0    1.0  1  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3566  Phenylalanine-4-hydroxylase (EC 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3566  Phenylalanine-4-hydroxylase (EC 1.14.16.1)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  419.1   0.0  2.4e-130  2.4e-130       3     247 ..      11     254 ..       9     255 .. 0.98

  Alignments for each domain:
  == domain 1  score: 419.1 bits;  conditional E-value: 2.4e-130
                                      TIGR01267   3 tvaqdldryseeehavwatlidrqlkllegracdeyldGveklgldadripdleevneklralt 66 
                                                    ++aq+++ y++eehavw+tli+rqlk++egrac+eyldG+eklgl++drip+l e+n++l ++t
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3566  11 PDAQGFIDYPAEEHAVWNTLITRQLKVVEGRACQEYLDGIEKLGLPHDRIPQLGEINKVLGETT 74 
                                                    789************************************************************* PP

                                      TIGR01267  67 GwkivavpglipadvffehlanrrfpvttflrtpeeldylqepdvfhdlfGhvpllsnpvfadf 130
                                                    Gw++++vp+lip+++ffe+lan++fpv+tf+rt+eeldylqepd+fh++fGh+pll+np+fa+f
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3566  75 GWQVARVPALIPFQTFFELLANKQFPVATFIRTREELDYLQEPDIFHEIFGHCPLLTNPWFAEF 138
                                                    **************************************************************** PP

                                      TIGR01267 131 leayGkkgvkakalgaallarlywytvefGlvetaaglriyGaGilsskkelvyaleskeplrv 194
                                                    +++yGk+g++a++++++ larlyw+t+efGlv+t++glriyG+Gilss+ke+vy+  s+ep+++
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3566 139 THTYGKLGLQASKEERVYLARLYWMTIEFGLVDTPQGLRIYGGGILSSPKETVYC-LSNEPEHQ 201
                                                    *******************************************************.89****** PP

                                      TIGR01267 195 afdllevmrtryridklqkayfvlpslkrlfdaaqedfealvaeakdlkaldp 247
                                                    afd+le mrt+yrid+lq++yfvlp+lkrlfd+a+ed++ +v++ ++l++ +p
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3566 202 AFDPLECMRTPYRIDILQPLYFVLPNLKRLFDLAHEDIMGMVKQGMQLGLRAP 254
                                                    ********************************************999988765 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (248 nodes)
Target sequences:                          1  (261 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 7.13
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory