Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate Pf1N1B4_572 Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)
Query= reanno::acidovorax_3H11:Ac3H11_3009 (578 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_572 Length = 341 Score = 191 bits (486), Expect = 3e-53 Identities = 112/345 (32%), Positives = 181/345 (52%), Gaps = 14/345 (4%) Query: 236 LTHRNILNNGFFIGECMKLTPADR------LCIPVPLYHCFGMVLGNLACFTHGATIVYP 289 LTHRN++ N +C L ++ L P+PLYH + +A G + Sbjct: 2 LTHRNLVANML---QCKALMGSNLNEGCEILITPLPLYHIYAFTFHCMAMMLIGNHNILI 58 Query: 290 NDGFDPLTVLQTVQDERCTGLHGVPTMFIAELDHPRFAEFNLSTLRTGIMAGSPCPTEVM 349 ++ D +++ + + +G G+ T+F+A ++ F + + S+L+ + G Sbjct: 59 SNPRDLTAMVKELSKWKFSGFVGLNTLFVALCNNEAFRKLDFSSLKITLSGGMALQLAAA 118 Query: 350 KRVVEQMNLREITIAYGMTETSPVSCQSSTDTPLSKRVSTVGQVQPHLEVKIVDPDTGAV 409 +R E I YGMTETSPV+ + + + ++ T+G P K++D D G Sbjct: 119 ERWKEVAGC-PICEGYGMTETSPVATVNPSQ---NIQIGTIGIPVPSTLCKVID-DAGVE 173 Query: 410 VPIGQRGEFCTKGYSVMHGYWGDEAKTREAIDEGGWMHTGDLATMDAEGYVNIVGRIKDM 469 P+G GE C KG VM GYW + T E +D GW+ TGD+A + +GY+ IV R KDM Sbjct: 174 QPLGAIGELCVKGPQVMKGYWQRQDATDEILDSEGWLKTGDIALIQPDGYMRIVDRKKDM 233 Query: 470 VIRGGENIYPREIEEFLYRHPQVQDVQVVGVPDQKYGEELCAWIIAKPGTQPTEDDIRAF 529 ++ G N+YP E+E+ L P V +GVPD+K GE + +I+AKPG T+D + Sbjct: 234 ILVSGFNVYPNELEDVLATLPGVLQCAAIGVPDEKSGEAIKIFIVAKPGVTLTKDQVMEH 293 Query: 530 CKGQIAHYKVPRYIRFVTSFPMTVTGKIQKFKIRDEMKDQLGLEE 574 + + YKVP+ + F + P T GKI + ++RDE +LG+++ Sbjct: 294 MRANVTGYKVPKAVEFRDALPTTNVGKILRRELRDEELKKLGVKK 338 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 455 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 578 Length of database: 341 Length adjustment: 32 Effective length of query: 546 Effective length of database: 309 Effective search space: 168714 Effective search space used: 168714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory