Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate Pf1N1B4_575 Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)
Query= BRENDA::A7KUK6 (562 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_575 Length = 505 Score = 191 bits (486), Expect = 4e-53 Identities = 151/494 (30%), Positives = 232/494 (46%), Gaps = 51/494 (10%) Query: 21 LFERKDRAYPDDKIIYQDADTQRHYTYKSLRDASLDFGKGLKALYEWRKGDVLALFTPNS 80 +FER + + D T TY L S F L+A + GD +A+ PN Sbjct: 29 VFERSCKKFADRPAFSNMGVT---LTYAELERYSAAFAGYLQAHTDLMPGDRIAVQMPNV 85 Query: 81 IDTPVVMWGTLWAGGTISPANPGYTVDELAFQLKNSHAKGLVTQASVLPVAREAAKKVGM 140 + P+ ++G L AG + NP YT E+ Q K+S A+ LV L V + ++V + Sbjct: 86 LHYPIAVFGALRAGLIVVNTNPLYTAREMRHQFKDSGARALV----YLNVFGQKVQEV-L 140 Query: 141 PEDRIILIGDQRDPD--------------ARVKHFTSVRNISGATRYRKQK-------IT 179 P+ I + + + D ++VK ++ A ++ I Sbjct: 141 PDTDIQYLIEAKMGDLMPTAKGWLVNTLVSKVKKMVPDYSLPQAISFKSALRLGRGLGIK 200 Query: 180 PAK----DVAFLVYSSGTTGVPKGVMISHRNIVANIRQ------QFIAEGEMLSWNGGPD 229 P D+A L Y+ GTTG+ KG M++H N+VAN++Q QF A+G+ L G Sbjct: 201 PLNVGLDDIAVLQYTGGTTGLAKGAMLTHGNLVANMQQARACLGQFGADGQPLLREGL-- 258 Query: 230 GKGDRVLAFLPFYHIYGLTCLITQALYKGYH-LIVMSKFDIEKWCAHVQNYRCSFSYIVP 288 + ++A LP YHIY T + G H +++ + DI + ++N+R S + Sbjct: 259 ---EVMIAPLPLYHIYAFTANCMCMMVTGNHNVLITNPRDIGNFIKELKNWRFSALLGLN 315 Query: 289 PVVLLLGKHPVVDKYDLSSLRMMNSGAAPLTQELVEAVYSRIKVGIKQGYGLSETSPTTH 348 + + L HP D SSL++ NSG L + E I +GYGL+ETSP Sbjct: 316 TLFVALMDHPDFKTLDFSSLKLTNSGGTALVKATAERWEQLTGCRITEGYGLTETSPVAC 375 Query: 349 SQRWEDWREAMGSVGRLMPNMQAKYMTMPEDGSEPKEVGEGEVGELYLKGPNVFLGYHEN 408 + + D + +G+VG +P K + E E GE GEL +KGP + GY + Sbjct: 376 TNPYGD-KSRIGTVGLPVPGTALKVIN-----DEGVEQSLGERGELCIKGPQIMKGYWQK 429 Query: 409 PEATKGCLSEDGWFQTGDVGYQDAKGNFYITDRVKELIKYKGFQVPPAELEGYLVDNDAI 468 PEAT L DGWF++GD+ D G I DR K++I GF V P E+E ++ + + Sbjct: 430 PEATADVLDADGWFKSGDIAVIDPDGFVRIVDRKKDMIIVSGFNVYPNEIEDVVMAHPKV 489 Query: 469 DDVAVIGIESETHG 482 + AVIG+ E G Sbjct: 490 ANCAVIGVPDERSG 503 Lambda K H 0.317 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 655 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 562 Length of database: 505 Length adjustment: 35 Effective length of query: 527 Effective length of database: 470 Effective search space: 247690 Effective search space used: 247690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory