Align pimeloyl-CoA dehydrogenase large subunit (EC 1.3.1.62) (characterized)
to candidate Pf1N1B4_966 Butyryl-CoA dehydrogenase (EC 1.3.99.2)
Query= metacyc::MONOMER-20676 (396 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_966 Length = 378 Score = 131 bits (330), Expect = 3e-35 Identities = 116/401 (28%), Positives = 192/401 (47%), Gaps = 41/401 (10%) Query: 5 FSKEEIAFRDEVRQFF-KDNVPAKTRQKLIEGRHNTKEEMVEWYRILNKKGWA---VTHW 60 FS E FRD VR F K+ VP + + K+ ++ ++ NK G A +H Sbjct: 7 FSSEHELFRDSVRTFLEKEAVPFHGQWE--------KQGYID-RQLWNKAGEAGMLCSHL 57 Query: 61 PKEYGGTGWSSVQHYIFNEEL-QAAPAPQPLAFGVSMVGPVIYTFGSEEQKKRFLPRIAN 119 P+EYGG G + + EE+ + + +V P I +GSE K ++LP++ + Sbjct: 58 PEEYGGLGADFLYSAVVIEEVGRLGLTGIGFSLHSDIVAPYILHYGSEALKHKYLPKLVS 117 Query: 120 VDDWWCQGFSEPGSGSDLASLKTKAEKKGDKWIINGQKTWTTLAQHADWIFCLCRTDPAA 179 + +EPG+GSDL +KT A GD+++ING KT+ T AD + + +TDP A Sbjct: 118 GEMVTAIAMTEPGAGSDLQGVKTTAVLDGDEYVINGSKTFITNGFLADLVIVVAKTDPKA 177 Query: 180 KKQEGISFILVDMKTKGITV-RPIQTID-GGHEVNEVFFDDVEVPLENLVGQENKGWDYA 237 +G S LV+ T G R ++ + + +E+FF DV VP ENL+GQ G+ Y Sbjct: 178 -GAKGTSLFLVEANTPGFAKGRRLEKVGMKAQDTSELFFQDVRVPKENLLGQAGMGFAYL 236 Query: 238 KFLLGNERTGIARVGM--SKERIRRIKQLAAQVESGGKPVIEDPKFRDKLAAVEIELKAL 295 L ER +A G+ ++ ++ + ++ GK + + R KLA + A Sbjct: 237 MQELPQERLTVAVGGLASAEAALQWTLDYTRERKAFGKAIADFQNTRFKLAEM-----AT 291 Query: 296 ELTQLRVVADE--GKHGKGKPN-PASSVLKIKGSEIQQATTELLMEVIGPFAAPYDVHGD 352 E+ RV D H +GK + P +++ K G+++Q + +++ G + Sbjct: 292 EIQIGRVFVDRCLELHLQGKLDVPTAAMAKYWGTDLQCKVLDECVQLHGGYG-------- 343 Query: 353 DDSNETMDWTAQIAPGYFNNRKVSIYGGSNEIQRNIICKAV 393 W IA + + R IY G+NEI + II +++ Sbjct: 344 ------FMWEYPIARAWADARVQRIYAGTNEIMKEIIARSL 378 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 378 Length adjustment: 30 Effective length of query: 366 Effective length of database: 348 Effective search space: 127368 Effective search space used: 127368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory