GapMind for catabolism of small carbon sources

 

Aligments for a candidate for AZOBR_RS08240 in Pseudomonas fluorescens FW300-N1B4

Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate Pf1N1B4_1380 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)

Query= uniprot:G8ALI9
         (505 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1380 Branched-chain amino
           acid transport system permease protein LivM (TC
           3.A.1.4.1)
          Length = 427

 Score =  369 bits (947), Expect = e-106
 Identities = 208/464 (44%), Positives = 278/464 (59%), Gaps = 52/464 (11%)

Query: 4   ISMSSPRAIAWPSILKEAAMTAFVALLLTIPLVGLRTVDRPTGLGLETRWNEVAAAVGLV 63
           +S ++ + I     L +A +   VAL++  P+VG+  +D   G G       VA  V +V
Sbjct: 1   MSSTTKKTIDLKRSLVDAILAGLVALIVFGPIVGV-VLD---GYGFNLEATRVAWIVAIV 56

Query: 64  FLGRLGLCLIREGHAVTVLVLAAAATAAGFFIAMPTEALRVILIAGGAVIAIRAVLAIRT 123
             GR  L L  +      ++    +T +G  +  P    R+                   
Sbjct: 57  MAGRFALSLFLQTPKGLRILEGFESTGSGVHVLPPDYKSRL------------------- 97

Query: 124 GRSKLSQAERDKRMDHIAAQVQHASRWLGPIAVVVALAFPFTPLADRQLLDIGILLLTYI 183
                                    RW+ P+ +V+A+ FPF   ++  LL + IL L Y+
Sbjct: 98  -------------------------RWIIPVMIVIAVVFPF--FSNSYLLGVVILGLIYV 130

Query: 184 MLGWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLAHYFGFSFWVCLPLAGFLAAMSGVLL 243
           +LG GLNIVVGLAGLLDLGYVAFYA+GAY  AL   Y G  FW  LPLA   A ++G +L
Sbjct: 131 LLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALGYQYLGLGFWTVLPLAAITAGLAGCIL 190

Query: 244 GFPVLRLRGDYFAIVTLGFGEIIRIILINWYQFTGGPNGISGIPRPSFFGIADFTRTPAE 303
           GFPVLRL GDY AIVTLGFGEIIR+IL NW   TGGPNG++  P P+FFG+ +F +   E
Sbjct: 191 GFPVLRLHGDYLAIVTLGFGEIIRLILNNWLSLTGGPNGMAA-PLPTFFGL-EFGKRAKE 248

Query: 304 GTAAFHEMFGLEFSPLHRIIFLYYLILVLALVVNLFTMRVRKLPLGRAWEALREDDIACA 363
           G   FHE FG+ ++P  +  F+Y ++ ++ L V     R+ ++P+GRAWEALRED+IAC 
Sbjct: 249 GGVPFHEFFGIAYNPDVKYYFIYAVLFLVVLAVLYIKHRLTRMPVGRAWEALREDEIACR 308

Query: 364 SLGINRTNMKLAAFAIAAMFGGFAGSFFATRQGFISPESFTFIESAIILAIVVLGGMGSQ 423
           S+G+N   +KL+AF I A   G AG FFAT QGF++P SFTF ESA+ILAIVVLGGMGS 
Sbjct: 309 SMGLNHVLVKLSAFTIGASTAGLAGVFFATYQGFVNPTSFTFFESALILAIVVLGGMGST 368

Query: 424 IGVVVAAFLVIGLPEAFRELADYRMLAFGMGMVLIMLWRPRGLL 467
           IGVV+AAF++   PE  R  A+YR+L FG+ MVL+M+WRPRGL+
Sbjct: 369 IGVVIAAFVLTVAPELLRGFAEYRVLLFGILMVLMMIWRPRGLI 412


Lambda     K      H
   0.329    0.144    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 691
Number of extensions: 48
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 2
Length of query: 505
Length of database: 427
Length adjustment: 33
Effective length of query: 472
Effective length of database: 394
Effective search space:   185968
Effective search space used:   185968
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory