Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate Pf1N1B4_1079 Lipopolysaccharide ABC transporter, ATP-binding protein LptB
Query= uniprot:D8IUY7 (241 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1079 Length = 241 Score = 122 bits (305), Expect = 8e-33 Identities = 72/239 (30%), Positives = 128/239 (53%), Gaps = 11/239 (4%) Query: 6 LKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHIE 65 LK Q L+ +Y Q V+ + L ++ G++V L+G NGAGKTT I G + A + I+ Sbjct: 4 LKAQHLAKSYKSRQVVRDVSLSIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVLID 63 Query: 66 YLG---QPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDKGQIAA--DI 120 L QP+ G+ K + +P+ +F ++S+ +N++ T + Q ++ Sbjct: 64 DLDVSHQPMHGR-----AKAGIGYLPQEASIFRKLSVADNIMAILETRKELDQAGRRQEL 118 Query: 121 DKWFAVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIF 180 + F + + +LSGGE++ + +ARAL ++PK +LLDEP G+ PI V I Sbjct: 119 ESLLQEF-HIHHIRDNLGMSLSGGERRRVEIARALATNPKFILLDEPFAGVDPISVGDIK 177 Query: 181 EVIRNVSAQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQMLDDPRVKAAYLG 239 ++I ++ A+GI +L+ + N + L+ Y++ G + +G + +L + VK YLG Sbjct: 178 QIIHHLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDSATILANELVKEVYLG 236 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 241 Length adjustment: 23 Effective length of query: 218 Effective length of database: 218 Effective search space: 47524 Effective search space used: 47524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory