Align HutW aka HISW, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate Pf1N1B4_2421 L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)
Query= TCDB::Q9KKE2 (285 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2421 Length = 281 Score = 213 bits (541), Expect = 5e-60 Identities = 117/257 (45%), Positives = 168/257 (65%), Gaps = 6/257 (2%) Query: 17 FIQALVTNYGWVFKAISGVILKAVLFIEWILRGLPWW--LVILAFMALACRS-SRRWSLT 73 F++ L N F AI+ + I + L W+ L ++ +AL R+W LT Sbjct: 16 FVEWLTQNGASTFDAIA---VSLETMIHGVTFALTWFNPLALIGLIALLAHFIQRKWGLT 72 Query: 74 LAVCALLETVGVLGIWDLTMQTLALMLMATIVSVVIGVPMGILVAKSRVVRNITLPVLDV 133 + V A + LG W TM+TLA +L AT+V V+IGVP+GI+ A + + PVLD+ Sbjct: 73 VFVIASFLLILNLGYWQETMETLAQVLFATLVCVLIGVPLGIVAAHKPMFYTVMRPVLDL 132 Query: 134 MQTMPSFVYLIPALMLFGLGKVPAILATIIYAVPPLIRLTDLGIRQVDAEVVEAATAFGG 193 MQT+P+FVYLIP L LFGLG VP +++T+++A+ IRLT LGIR V E+++A AFG Sbjct: 133 MQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVPDELMDAGKAFGC 192 Query: 194 SPGQILFGVELPLATPTIMAGLNQTIMMALSMVVVASMIGARGLGEQVLNGIQTLDVGKG 253 S Q+L +ELP A P+I AG+ Q IM++LSMVV+A+++GA GLG+ V+N + T D+ G Sbjct: 193 SRRQLLSRIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPVVNALNTADIALG 252 Query: 254 LEAGIGIVILAVVLDRI 270 EAG+ IV+LA++LDRI Sbjct: 253 FEAGLAIVLLAIMLDRI 269 Lambda K H 0.327 0.142 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 281 Length adjustment: 26 Effective length of query: 259 Effective length of database: 255 Effective search space: 66045 Effective search space used: 66045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory