Align Ectoine/proline transporter ProP (characterized)
to candidate Pf1N1B4_183 Major facilitator family transporter
Query= SwissProt::Q79VC4 (504 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_183 Length = 433 Score = 203 bits (517), Expect = 9e-57 Identities = 122/420 (29%), Positives = 210/420 (50%), Gaps = 18/420 (4%) Query: 30 RPAIKGTVVGNFMEWYDFGIYGYLT-VTMTAVFTQGLPQEWQLLAVMFGFAVSYLVRPLG 88 R A +G +E+YDF IY + + VF LA FAV ++ RP+ Sbjct: 8 RRAAAAAFIGTTIEFYDFYIYATAAALVLGQVFFPSHDPVMSTLAAFGSFAVGFIARPMA 67 Query: 89 GLVLGPLGDKVGRQKVLYVTMAMMAVSTALIGLLPTAASIGAWALVLLYLLKMVQGFSTG 148 G+V G LGD++GR+K+L VTMA+M ++T IG+LP+ AS G WA + L +L+++QG S G Sbjct: 68 GMVFGHLGDRLGRKKMLLVTMALMGLATTGIGMLPSYASAGIWAPIGLIVLRLIQGISVG 127 Query: 149 GEYAGATTYVAEFAPDRRRGFFGAFLDMGSYLGFAAGASVVAITTWVTTHFYGATAMEDF 208 GE+ GA +E AP +R+ F+ +F +GS G + T + + A + Sbjct: 128 GEWGGAVLMASEHAPAKRKTFYASFAQLGSPAGLLLALIAFRLVTSLEPEDFLA-----W 182 Query: 209 GWRIPFLTAIPLGIIAVYLRTRIPETPAFENNQDEPNAVVEKDTEDPYARLGLAGVIRHH 268 GWR+PFL + L ++ + +R+ + E+P F +D + A+ + VIR Sbjct: 183 GWRLPFLASGVLMMVGLMIRSGVHESPEFAKAKD----------NNETAKYPVKDVIRTC 232 Query: 269 WRPLLIGIAIVAATNTAGYALTSYMPVYLEEQIGLHSASAAAVTVPILVVMSLLLPFVGM 328 WR +L A V + + ++M Y+ + G+ ++ + V+ L P + Sbjct: 233 WRQILFAAAAVTIGSAGFFFTNTFMITYVTQYQGIPRSTILDCLFLVTVIQLLSQPLSAL 292 Query: 329 WSDRVGRKPVYATAVAATLILMVPAFLIMNTGTIGAVLIALSMVAIPTGLYVALSASALP 388 ++R+G ++ P FL++ T I + + +++ + A+ A + Sbjct: 293 LAERIGEGRFLKLVALLCMVTPYPMFLLVGTQNIVLMTVGIALAVVILSALYAVIAGYMT 352 Query: 389 ALFPTASRFSGMGISYNISVSLFGGTTPLITQFLLQKTGLDIVPALYIMFFSAIAGVALL 448 FP R+SG+ I+Y +S +L GGTTPLI L K +P +FF+ ++ ++L+ Sbjct: 353 QAFPVHLRYSGISIAYQLSCALAGGTTPLIGTLLASKFSGQWLP--LAVFFTLLSALSLI 410 Lambda K H 0.322 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 559 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 504 Length of database: 433 Length adjustment: 33 Effective length of query: 471 Effective length of database: 400 Effective search space: 188400 Effective search space used: 188400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory