GapMind for catabolism of small carbon sources

 

Aligments for a candidate for patA in Pseudomonas fluorescens FW300-N1B4

Align putrescine-pyruvate transaminase (EC 2.6.1.113) (characterized)
to candidate Pf1N1B4_1239 Omega-amino acid--pyruvate aminotransferase (EC 2.6.1.18)

Query= BRENDA::Q9I6J2
         (456 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1239 Omega-amino
           acid--pyruvate aminotransferase (EC 2.6.1.18)
          Length = 449

 Score =  273 bits (697), Expect = 1e-77
 Identities = 162/451 (35%), Positives = 244/451 (54%), Gaps = 17/451 (3%)

Query: 7   NAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVN 66
           NA T     L  D H  P+T  +   ++  R+I  AEG ++ D +G K+ D+++GLW   
Sbjct: 6   NAPTSLASQLKLDAHWMPYTANRNF-QRDPRLIVAAEGSWLTDDKGRKVYDSLSGLWTCG 64

Query: 67  VGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEA 126
            G+ R+E+ +A  +Q+  L  Y+  FQ  HP   +LA+ I D+ P  +NHVFFT SGSE 
Sbjct: 65  AGHTRKEIQEAVAKQLGTLD-YSPGFQYGHPLSFQLAEKITDLTPGNLNHVFFTDSGSEC 123

Query: 127 NDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHI 186
            DT ++MVR YW  KGQ  K  +IGR  GYHG  +AG SLGG+    +     +  + H+
Sbjct: 124 ADTAVKMVRAYWRLKGQATKTKMIGRARGYHGVNIAGTSLGGVNGNRKLFGQAMMDVDHL 183

Query: 187 AQPYWYGEGGDMS-PDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYW 245
                         P++ G+  A++L K I      N+AA   EP+ G+ GV+VPP  Y 
Sbjct: 184 PHTLLASNAFTRGMPEQGGIALADELLKLIELHDASNIAAVFVEPLAGSAGVLVPPQGYL 243

Query: 246 PKIREILAKYDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVV 305
            ++REI  +++IL + DEVI GFGRTG  FG+  +G  PDLM IAK +T+G IPMG V+ 
Sbjct: 244 KRLREICDQHNILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTNGAIPMGAVIA 303

Query: 306 RDEIVEV-LNQGG-----EFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYL 359
             EI +  +NQ       EF HG+TYS HPVA A  L  + +L++E +++ V AE AP+ 
Sbjct: 304 SSEIYQTFMNQATPEYAVEFPHGYTYSAHPVACAAGLAALDLLQKENLVQSV-AEVAPHF 362

Query: 360 QKRWQELADHPLVGEARGVGMVAALELV-KNKKTRERFTDKGVGMLCREHCFRNGLIMRA 418
           +     L     V + R  G+  A+++  ++     R  + G+ +      ++ G  +R 
Sbjct: 363 ENALHGLKGSKNVIDIRNYGLAGAIQIAPRDGDAIVRPFEAGMAL------WKAGFYVRF 416

Query: 419 VGDTMIISPPLVIDPSQIDELITLARKCLDQ 449
            GDT+   P     P  +D L     + L++
Sbjct: 417 GGDTLQFGPTFNSKPQDLDRLFDAVGEVLNK 447


Lambda     K      H
   0.320    0.138    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 541
Number of extensions: 27
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 456
Length of database: 449
Length adjustment: 33
Effective length of query: 423
Effective length of database: 416
Effective search space:   175968
Effective search space used:   175968
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory