Align putrescine-pyruvate transaminase (EC 2.6.1.113) (characterized)
to candidate Pf1N1B4_2377 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase (EC 2.6.1.62)
Query= BRENDA::Q9I6J2 (456 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2377 Length = 468 Score = 229 bits (583), Expect = 2e-64 Identities = 138/431 (32%), Positives = 217/431 (50%), Gaps = 9/431 (2%) Query: 24 PFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMR 83 P T K + I + EGV++ D EG + LDA++ W G+ + Q Q+ Sbjct: 18 PCTQMKDHEQLPLIPIKRGEGVWLEDFEGKRYLDAVSSWWVNVFGHANPRINQRIKDQVD 77 Query: 84 ELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQ 143 +L + + +H PV+EL++ + + PEG+ F+ +GS + L+M HYW +GQ Sbjct: 78 QLE-HVILAGFSHQPVIELSERLVKMTPEGLTRCFYADNGSSCIEVALKMSFHYWLNRGQ 136 Query: 144 PQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEF 203 P KK + NGYHG T+A +++G + E + + + P Y MS +E Sbjct: 137 PNKKRFVTLTNGYHGETMAAMAVGDVPLFTETYKALLMDTIKVPSPDCYLRPEGMSWEEH 196 Query: 204 GVWAAEQLEKKILEVGEENVAAFIAEP-IQGAGGVIVPPDTYWPKIREILAKYDILFIAD 262 +E+ + + + VAA I EP IQGAGG+ + Y +R+ +Y + I D Sbjct: 197 SRNMFAAMEQTLAD-NHDTVAAVILEPLIQGAGGMRMYHPVYLKLLRDACDRYGVHLIHD 255 Query: 263 EVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQG----GE 318 E+ GFGRTG F + G PD + ++K LT GY+P+ V+ DE+ Sbjct: 256 EIAVGFGRTGTMFACEQAGIRPDFLCLSKALTGGYLPLAAVLTTDEVYGAFYDDYPTLRA 315 Query: 319 FYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGV 378 F H +Y+G+P+A A AL + I E+ +IE K A + LADHP V E R Sbjct: 316 FLHSHSYTGNPLACAAALATLDIFEEDNVIENNKV-LAQRMASSTAHLADHPNVAEVRQT 374 Query: 379 GMVAALELVKNKKTRERFT-DKGVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQID 437 GMV A+E+VK+K ++ + + G+ +H G ++R +G + PP VI P QID Sbjct: 375 GMVLAIEMVKDKASKTAYPWQERRGLRVFQHALERGALLRPLGSVVYFLPPYVITPEQID 434 Query: 438 ELITLARKCLD 448 L +A + +D Sbjct: 435 FLAEVASEGID 445 Lambda K H 0.320 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 589 Number of extensions: 38 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 468 Length adjustment: 33 Effective length of query: 423 Effective length of database: 435 Effective search space: 184005 Effective search space used: 184005 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory