GapMind for catabolism of small carbon sources

 

Aligments for a candidate for potA in Pseudomonas fluorescens FW300-N1B4

Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate Pf1N1B4_3027 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)

Query= CharProtDB::CH_024626
         (378 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3027 Putrescine transport
           ATP-binding protein PotA (TC 3.A.1.11.1)
          Length = 372

 Score =  268 bits (686), Expect = 1e-76
 Identities = 152/358 (42%), Positives = 207/358 (57%), Gaps = 24/358 (6%)

Query: 18  VQLAGIRKCFDGKEVIPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIMLD 77
           VQ   + + F   + + ++ + I +GEF ++LGPSG GKTT LRLIAG E   +G I + 
Sbjct: 32  VQFTNVSRQFGEVKAVDRVSIDIQDGEFFSMLGPSGSGKTTCLRLIAGFEQPSAGSIRIH 91

Query: 78  NEDITHVPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPRVMEALRMVQL 137
             +   +P   R VNTVFQ YALFPHM V +NVA+GL+++     E   R  EAL MV L
Sbjct: 92  GAEAAGLPPYQRDVNTVFQDYALFPHMNVLDNVAYGLKVKGVGKTERQKRAEEALDMVAL 151

Query: 138 ETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQRKL 197
             + +RKP QLSGGQ+QRVA+ARA+VN+PR+LLLDE L ALD KLR+QMQ ELK LQR+L
Sbjct: 152 GGYGERKPVQLSGGQRQRVALARALVNRPRVLLLDEPLGALDLKLREQMQGELKKLQRQL 211

Query: 198 GITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGEINMFNAT 257
           GITF+FVTHDQ EAL+MSDR+ V   GRIEQ  TPR +Y +P   FVA F+G  N+    
Sbjct: 212 GITFIFVTHDQTEALSMSDRVAVFNKGRIEQVDTPRNLYMKPATTFVAEFVGTSNVIRGD 271

Query: 258 VIERLDEQRVRANVEGRECNIYVNFAVEPGQKLHVLLRPEDLRVEEINDDNHAEGLIGYV 317
           + ++L                        G      +RPE +R  E    +H   + G +
Sbjct: 272 LAQQLS-----------------------GNPQPFSIRPEHVRFAEGPLASHEIEVSGLL 308

Query: 318 RERNYKGMTLESVVELENGKMVMVSEF-FNEDDPDFDHSLDQKMAINWVESWEVVLAD 374
            +  Y+G      ++LENG+ + +S+      D    H   Q+++  W     + L D
Sbjct: 309 HDIQYQGSATRYELKLENGQTLNISQANVQWLDVSTQHQTGQRISARWAREAMIPLHD 366


Lambda     K      H
   0.319    0.136    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 330
Number of extensions: 10
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 378
Length of database: 372
Length adjustment: 30
Effective length of query: 348
Effective length of database: 342
Effective search space:   119016
Effective search space used:   119016
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory