Align D-ribose-binding periplasmic protein; EC 3.6.3.17 (characterized)
to candidate Pf1N1B4_4386 Inositol transport system sugar-binding protein
Query= CharProtDB::CH_003593 (296 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4386 Length = 308 Score = 129 bits (325), Expect = 6e-35 Identities = 79/277 (28%), Positives = 145/277 (52%), Gaps = 6/277 (2%) Query: 23 AMAKDTIALVVSTLNNPFFVSLKDGAQKEADKLGYNLVVLDSQNNPAKELANVQDLTVRG 82 A A I + ++ +++ F ++ G + A K + D+Q + ++L VQ + Sbjct: 19 AAASYRIGVSIARVDDNFMTYVRSGLEDAARKENVQIQFEDAQGDVVRQLNQVQGFLGQK 78 Query: 83 TKILLINPTDSDAVGNAVKMANQANIPVITLDRQATKGEV---VSHIASDNVLGGKIAGD 139 +++ P D+ A N + A +A IP++ ++R + + V +AS++V G++ Sbjct: 79 VDAVIVLPVDTAATANMTRAAVEAKIPLVYVNRHPDERVLPKGVVTVASNDVEAGQLQMR 138 Query: 140 YIAKKAGEGAKVIELQGIAGTSAARERGEGFQQAVAAHK-FNVLASQPADFDRIKGLNVM 198 Y+A+K + ++G ++ ++R EG Q + + ++ Q A++ R KG+++ Sbjct: 139 YLAEKMAGKGNIAIIKGDLAQNSTQDRTEGVNQVLKDYPGIKIVEQQSAEWQRNKGMDLT 198 Query: 199 QNLLTAHPDVQAVFAQNDEMALGALRALQTAGKS--DVMVVGFDGTPDGEKAVNDGKLAA 256 N L A D A+ A NDEMA+GA ALQ AGK+ ++ +VG DG PDG A+ G L A Sbjct: 199 SNWLLAGADFDAIVANNDEMAIGAAMALQQAGKAKGEIAIVGIDGLPDGLAAIKRGMLVA 258 Query: 257 TIAQLPDQIGAKGVETADKVLKGEKVQAKYPVDLKLV 293 ++ Q P ++ A K++KGE V+ V +L+ Sbjct: 259 SVFQDPKAQATSALQAAIKMIKGEPVETDVWVPFQLI 295 Lambda K H 0.313 0.129 0.344 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 308 Length adjustment: 27 Effective length of query: 269 Effective length of database: 281 Effective search space: 75589 Effective search space used: 75589 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory