Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate Pf1N1B4_3215 Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)
Query= uniprot:A0A165KC78 (242 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3215 Length = 255 Score = 119 bits (299), Expect = 4e-32 Identities = 79/257 (30%), Positives = 138/257 (53%), Gaps = 24/257 (9%) Query: 6 NKVLLQVKGLKVAYGGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDGN 65 ++ +L+V L + +GG+ AV V V+E ++VS+IG NGAGKTT +TG G+ Sbjct: 2 SREILKVTDLSMRFGGLLAVNSVALTVKEKQVVSMIGPNGAGKTTVFNCLTGFYQPTAGS 61 Query: 66 IEYLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAGILADIEKM 125 I G+ I+G + +G+V + +F MT ENL + + R LA + K Sbjct: 62 IVLDGEQIQGLPGHKIALKGVVRTFQNVRLFKDMTAVENLLIAQH-RHLNTNFLAGLFKT 120 Query: 126 FTIFPR-----------------LRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDE 168 F R L+E ++ AGT++ G+Q+ L + R +M++P++L+LDE Sbjct: 121 -PAFRRSEREAMEYAEYWLEKVNLKEFANRPAGTLAYGQQRRLEIARCMMTRPRILMLDE 179 Query: 169 PSMGLSPIMVD---KIFEVVRDVYALGVTIVLVEQNASRALAIADRGYVMESGLITMTGP 225 P+ GL+P + + ++R+ + VT++L+E + ++I+D +V+ G G Sbjct: 180 PAAGLNPRETEDLKALIGILREEH--DVTVLLIEHDMKLVMSISDHIFVINQGTPLADGT 237 Query: 226 GQQLLNDPKVRAAYLGE 242 +Q+ ++P+V AYLGE Sbjct: 238 PEQIRDNPEVIKAYLGE 254 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 255 Length adjustment: 24 Effective length of query: 218 Effective length of database: 231 Effective search space: 50358 Effective search space used: 50358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory