Align ABC transporter permease (characterized, see rationale)
to candidate Pf1N1B4_1344 Urea ABC transporter, permease protein UrtB
Query= uniprot:A0A165KC95 (309 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1344 Length = 499 Score = 112 bits (279), Expect = 2e-29 Identities = 93/308 (30%), Positives = 150/308 (48%), Gaps = 15/308 (4%) Query: 4 LLQQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGAMPG 63 +L Q +G+ LGS+ L ALG + +G++ +IN AHGE+LM+GA +++ M Q P Sbjct: 203 MLGQAFSGMSLGSILLLAALGLAITFGLLGVINMAHGEMLMLGAYSTYVVQLMFQRFAPQ 262 Query: 64 APGWVILLLATIIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSI-LLQTLAMII 122 A + L+A +A V A + +E+ R L P L L+ G+S+ L+Q + ++ Sbjct: 263 AIEF-YPLIALPVAFFVTAGIGMALERTVIRHLYGRP-LETLLATWGISLMLIQLVRLVF 320 Query: 123 WKPNYKPYPTMLPSSPFEIGGAFITPTQILILGVTAVALASLVY-LVNHTNLGRAMRATA 181 N + S ++ + P +++ A+ + L + L+N T LG +RA Sbjct: 321 GAQNVEVANPAWLSGGIQVLPNLVLPYNRIVIIAFALFVVVLTWLLLNKTRLGLNVRAVT 380 Query: 182 ENPRVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFTAAVF 241 +N +A+ GV V F +G+ +A + G+ S G +G + +F V Sbjct: 381 QNRNMAACCGVPTGRVDMLAFGLGSGIAGLGGVA-LSQIGNVGPDLGQSYIIDSFLVVVL 439 Query: 242 GGIGNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRPSGL- 300 GG+G LAG+V+ LG+ I IG + G +L I A I+L I RP GL Sbjct: 440 GGVGQLAGSVLAAFGLGIANKILEPQIGAVLGKIL------ILALIILFI--QKRPQGLF 491 Query: 301 -LGERVAD 307 L RV D Sbjct: 492 ALKGRVID 499 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 499 Length adjustment: 31 Effective length of query: 278 Effective length of database: 468 Effective search space: 130104 Effective search space used: 130104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory