GapMind for catabolism of small carbon sources

 

Alignments for a candidate for sdh in Pseudomonas fluorescens FW300-N1B4

Align D-sorbitol dehydrogenase small subunit (EC 1.1.99.21) (characterized)
to candidate Pf1N1B4_821 Glucose dehydrogenase, PQQ-dependent (EC 1.1.5.2)

Query= metacyc::MONOMER-13709
         (126 letters)



>FitnessBrowser__pseudo1_N1B4:Pf1N1B4_821
          Length = 802

 Score = 73.6 bits (179), Expect = 6e-18
 Identities = 44/102 (43%), Positives = 59/102 (57%), Gaps = 2/102 (1%)

Query: 14  LTLLLGVIVLLVGLFFVIGGADLAMLGGSTYYVLCGILLVASGVFMLMGRTLGAFLYLGA 73
           L  LLG+++LL+GL  + GG  L+MLGGS YY+L GI L+ +G  +L  R     LY   
Sbjct: 13  LPSLLGIVLLLMGLALLAGGIKLSMLGGSLYYLLAGIGLMLTGGLLLADRYAALSLYAVV 72

Query: 74  LAYTWVWSFWEVGFSPIDLLPRAFGPTILGILVALTIPVLRR 115
           L  + VW+ WEVG     L+PR      LGI++ L  P  RR
Sbjct: 73  LFASTVWALWEVGLDWWQLVPRLALLFALGIVMLL--PWFRR 112


Lambda     K      H
   0.331    0.148    0.471 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 231
Number of extensions: 14
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 126
Length of database: 802
Length adjustment: 27
Effective length of query: 99
Effective length of database: 775
Effective search space:    76725
Effective search space used:    76725
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory