Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate Pf1N1B4_4785 Probable acyl-CoA dehydrogenase (EC 1.3.99.3)
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4785 Length = 253 Score = 106 bits (265), Expect = 4e-28 Identities = 67/214 (31%), Positives = 113/214 (52%), Gaps = 15/214 (7%) Query: 5 LNLKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQSSGNYNFWPT--DISS 62 + ++ K+ VTGGASG+G A + L+A GA V ++D++ + DIS+ Sbjct: 1 MQIENKVFLVTGGASGLGAATAEMLVAAGAKVMLVDMNAEAVAAQAARLGAQSVVADISN 60 Query: 63 ASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNINQKG 122 + V ++ FG ++GLVN AG+ ++ + P +F +++N+N G Sbjct: 61 EAAAQAAVQATVKAFGGLNGLVNCAGIVRGEKILGKNGPHAL-----DSFSQVINVNLIG 115 Query: 123 VFLMSQAVARQMVKQRS------GVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSK 176 F M + A + + + GVI+N +S + +G GQ+ Y+A+K A+ S T ++ Sbjct: 116 SFNMLRLAATAIAETEADEDGERGVIINTASAAAFDGQIGQAAYSASKGAIVSLTLPAAR 175 Query: 177 ELGKHGIRVVGVAPGILEKTGL--RTPEYEEALA 208 EL + GIRV+ +APGI E + TPE E+LA Sbjct: 176 ELARFGIRVMTIAPGIFETPMMAGMTPEVRESLA 209 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 253 Length adjustment: 24 Effective length of query: 243 Effective length of database: 229 Effective search space: 55647 Effective search space used: 55647 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory