GapMind for catabolism of small carbon sources

 

Aligments for a candidate for frcA in Pseudomonas fluorescens FW300-N1B4

Align ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale)
to candidate Pf1N1B4_1243 ABC transporter ATP-binding protein

Query= uniprot:A0A0C4Y5F6
         (540 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1243 ABC transporter
           ATP-binding protein
          Length = 521

 Score =  261 bits (666), Expect = 6e-74
 Identities = 176/501 (35%), Positives = 260/501 (51%), Gaps = 20/501 (3%)

Query: 1   MSDMSDTSTKAPLLALRNICKTFPGVRALRKVELTAYAGEVHALMGENGAGKSTLMKILS 60
           MS+      + P L LR I K +PG  A   ++L+   GE+HAL+GENGAGKSTLMKI+ 
Sbjct: 1   MSNPVPIPDQIPRLQLRRISKRYPGCLANDAIDLSIAPGEIHALLGENGAGKSTLMKIIY 60

Query: 61  GAYTADPGGECHIDGQRVQIDGPQSARDLGVAVIYQELSLAPNLSVAENIYLGRALQRRG 120
           G   AD  GE    GQRV +  P  AR LG+ +++Q  SL   LSVA+NI L        
Sbjct: 61  GVTHAD-SGEMIWQGQRVTMRNPAQARGLGIGMVFQHFSLFETLSVAQNIALAMGAAAGT 119

Query: 121 LVARGDMVRACAPTLARLGADFSPAANVASLSIAQRQLVEIARAVHFEARILVMDEPTTP 180
                  +R  +    R G    P   V SLSI +RQ VEI R +  + R+L++DEPT+ 
Sbjct: 120 PKQLEPKIREVSQ---RYGMALEPERLVHSLSIGERQRVEIIRCLMQDIRLLILDEPTSV 176

Query: 181 LSTHETDRLFALIRQLRGEGMAILYISHRMAEIDELADRVTVLRDGCFVGTLDRAHLSQA 240
           L+  E D LF  +R+L  EG +IL+ISH++ E+  L    TVLR G   G    A  S  
Sbjct: 177 LTPQEADELFVTLRRLAAEGCSILFISHKLGEVRALCHSATVLRGGRVAGHCVPAQCSDR 236

Query: 241 ALVKMMVGR--DLSGFYTKTHGQAVEREVMLSVRDVA------DGRRVKGCSFDLRAGEV 292
            L ++MVG   +L   Y K  G     +  LSV  ++       G  +K   FD+R+GE+
Sbjct: 237 QLAQLMVGEAAELITDYPKVMG----ADAFLSVTGLSWHNPDPFGCSLKNIDFDVRSGEI 292

Query: 293 LGLAGLVGAGRTELARLVFGADARTRGEVRIANPAGSGGLVTLPAGGPRQAIDAGIAYLT 352
           +G+AG+ G G+ EL  L+ G +   R +    +  G       P    +     G+A++ 
Sbjct: 293 VGVAGVAGNGQDELLALLSGEERLPRDDSATISFGGQPVAHLRPDARRK----LGLAFVP 348

Query: 353 EDRKLQGLFLDQSVHENINLIVAARDALGLGRLNRTAARRRTTEAIDTLGIRVAHAQVNV 412
            +R   G   + S+ +N  L    +  +  G + R   +    + I   G++   +    
Sbjct: 349 AERLGHGAVPELSLADNALLTAFQQGLVSHGLVQRGKVQALAEDIIRRFGVKTPDSLAPA 408

Query: 413 GALSGGNQQKVMLSRLLEIQPRVLILDEPTRGVDIGAKSEIYRLINALAQSGVAILMISS 472
            +LSGGN QK +L R +  QP++L+   PT GVD+GA + I+R + AL  +G AIL+IS 
Sbjct: 409 RSLSGGNLQKFILGREILQQPKLLVAAHPTWGVDVGAAATIHRALIALRDAGAAILVISE 468

Query: 473 ELPEVVGLCDRVLVMREGTLA 493
           +L E+  +CDR+  +  G L+
Sbjct: 469 DLDELFQICDRLGALCGGQLS 489



 Score = 74.3 bits (181), Expect = 1e-17
 Identities = 73/247 (29%), Positives = 109/247 (44%), Gaps = 26/247 (10%)

Query: 278 RRVKGC------SFDLRAGEVLGLAGLVGAGRTELARLVFGADARTRGEVRIANPAGSGG 331
           +R  GC         +  GE+  L G  GAG++ L ++++G      GE+        G 
Sbjct: 21  KRYPGCLANDAIDLSIAPGEIHALLGENGAGKSTLMKIIYGVTHADSGEM-----IWQGQ 75

Query: 332 LVTLPAGGPRQAIDAGIAYLTEDRKLQGLFLDQSVHENINLIVAARDALGLGRLNRTAAR 391
            VT+    P QA   GI  + +   L   F   SV +NI L      A+G          
Sbjct: 76  RVTMR--NPAQARGLGIGMVFQHFSL---FETLSVAQNIAL------AMGAAAGTPKQLE 124

Query: 392 RRTTEAIDTLGIRVAHAQVNVGALSGGNQQKVMLSRLLEIQPRVLILDEPTRGVDIGAKS 451
            +  E     G+ +   ++ V +LS G +Q+V + R L    R+LILDEPT  +      
Sbjct: 125 PKIREVSQRYGMALEPERL-VHSLSIGERQRVEIIRCLMQDIRLLILDEPTSVLTPQEAD 183

Query: 452 EIYRLINALAQSGVAILMISSELPEVVGLCDRVLVMREGTLAGEVRPAGSAAETQERIIA 511
           E++  +  LA  G +IL IS +L EV  LC    V+R G +AG   PA     +  ++  
Sbjct: 184 ELFVTLRRLAAEGCSILFISHKLGEVRALCHSATVLRGGRVAGHCVPAQC---SDRQLAQ 240

Query: 512 LATGAAA 518
           L  G AA
Sbjct: 241 LMVGEAA 247


Lambda     K      H
   0.320    0.136    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 663
Number of extensions: 32
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 540
Length of database: 521
Length adjustment: 35
Effective length of query: 505
Effective length of database: 486
Effective search space:   245430
Effective search space used:   245430
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory