GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fruI in Pseudomonas fluorescens FW300-N1B4

Align Phosphoenolpyruvate--protein phosphotransferase (EC 2.7.3.9) (characterized)
to candidate Pf1N1B4_833 PTS system, glucose-specific IIA component / Phosphotransferase system, phosphocarrier protein HPr / Phosphoenolpyruvate-protein phosphotransferase of PTS system (EC 2.7.3.9)

Query= reanno::psRCH2:GFF3291
         (960 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_833 PTS system,
           glucose-specific IIA component / Phosphotransferase
           system, phosphocarrier protein HPr /
           Phosphoenolpyruvate-protein phosphotransferase of PTS
           system (EC 2.7.3.9)
          Length = 844

 Score =  519 bits (1336), Expect = e-151
 Identities = 306/680 (45%), Positives = 411/680 (60%), Gaps = 24/680 (3%)

Query: 284 SAQVPLANAHGLHARPAKVLTEIAQAFEGEIRVRLAGTESAGVSVKSLSKLLAMGAHRGQ 343
           S  V L N +GLHARPA V  + A+ F   I +     +    + KSL  ++A+    G 
Sbjct: 172 SKPVTLPNTNGLHARPAAVFAQAAKGFAASICLH---KQQDSANAKSLVAIMALQTAHGD 228

Query: 344 LLEFMAEPAIASDALPALVRAVEEGLGEEVEPLPAPGEASEPPVTAQGPAESAIDQAALR 403
           +L+  A  A A  A+  L   +  G GE V  +                AE     A + 
Sbjct: 229 VLQVSAAGADAEVAIKTLAELLAAGCGEAVTLM----------------AEVETVAAQVS 272

Query: 404 AGDQVNGIAASPGIAIGPVLVRKPQVIDYPKRGESPVIELQRLDAALDKVHADIGTLIDE 463
           +   + G+ ASPG A G V+    Q ++  + G SP +E + L  AL K    +  L D+
Sbjct: 273 SLTVLRGVCASPGAAFGQVVQIAEQTLEVSESGVSPQVEREHLSRALAKAVLALQQLRDK 332

Query: 464 SQVASIRDIFTTHQAMLKDPALREEVQVRLQKGLSAEAAWMEEIESAAQQQEALHDKLLA 523
           +   +  DIF  HQ +L+DP L ++    +  G SA  AW    ES A   + L + LLA
Sbjct: 333 ATGDAQADIFKAHQELLEDPGLLDQALALIDAGKSAGFAWRAATESTATLFKKLGNALLA 392

Query: 524 ERAADLRDVGRRVLACLTGVE--AEQAPDEPYILVMDEVAPSDVATLNAQRVAGILTAGG 581
           ERAADL DVG+RVL  + GVE  A + PD   IL+ +++ PS  A L+ ++V G  T GG
Sbjct: 393 ERAADLADVGQRVLKLILGVEDRAMELPDGA-ILIAEQLTPSQTAGLDTRKVLGFATVGG 451

Query: 582 GATSHSAIIARALGIPAIVGAGPGVLGLARNTLLLLDGERGELLVAPSGAQLEQARSERA 641
           GATSH AI+ARA G+PAI G    VL L   T +LLD ++GEL + P  A +EQ ++ R 
Sbjct: 452 GATSHVAILARASGLPAICGLPVQVLTLINGTRVLLDADKGELQLDPELAAIEQLQANRQ 511

Query: 642 AREERKHLANERRMDAAVTRDGHPVEIAANIGAAGETPEAVAMGAEGIGLLRTELVFMNH 701
            +++R+         AA TRDGH VEI ANI +  E  +A+A+G +G+GLLR+E ++++ 
Sbjct: 512 LQKQRQQYELANAGLAARTRDGHHVEITANIASLAEAEQAMALGGDGVGLLRSEFLYLDR 571

Query: 702 SQAPNQATQEAEYRRVLEAL-EGRPLVVRTLDVGGDKPLPYWPMPAEENPFLGVRGIRLS 760
           + AP+   Q + Y  +  AL   R LVVRTLDVGGDKPL Y PM  E NPFLG+RGIRL 
Sbjct: 572 NHAPSHDEQASTYGAIARALGPARNLVVRTLDVGGDKPLAYVPMDRETNPFLGMRGIRLC 631

Query: 761 LQRPDILETQLRALLASADGRPLRIMFPMVGNIDEWRTAKAMVDRLRVELPVADL-QVGI 819
           L+RP +L  Q +A+L+SA    L IM PMV  + E R A+ +++   + L + +L ++GI
Sbjct: 632 LERPQLLRDQFKAILSSAGLARLHIMLPMVTQLSELRLARQLLEEEALALGLTELPKLGI 691

Query: 820 MIEIPSAALIAPVLAQEVDFFSIGTNDLTQYTLAIDRGHPTLSGQADGLHPAVLRLIGMT 879
           MIE+P+AAL+A + A EVDFFSIGTNDLTQYTLA+DR HP L+ QAD  HP+VLRLI  T
Sbjct: 692 MIEVPAAALMADLFAPEVDFFSIGTNDLTQYTLAMDRDHPRLASQADSFHPSVLRLIATT 751

Query: 880 VEAAHAHGKWVGVCGELAADALAVPLLVGLGVDELSVSARSIALVKARVRELDFAACQRL 939
           V+AAHAHGKWVGVCG LA++ LAVPLL+GLGVDELSVS   I  +KA VRE+D   CQ +
Sbjct: 752 VKAAHAHGKWVGVCGALASEKLAVPLLLGLGVDELSVSVPLIPAIKAAVREVDLLDCQAI 811

Query: 940 AQQALMLPGAHEVRAFVGEH 959
           AQQ L L  A +VR  +  H
Sbjct: 812 AQQVLGLESAEQVREALRRH 831


Lambda     K      H
   0.317    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1626
Number of extensions: 69
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 960
Length of database: 844
Length adjustment: 43
Effective length of query: 917
Effective length of database: 801
Effective search space:   734517
Effective search space used:   734517
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory