Align UTP-glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (characterized)
to candidate Pf1N1B4_5948 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)
Query= BRENDA::O25363 (273 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5948 Length = 277 Score = 375 bits (964), Expect = e-109 Identities = 177/266 (66%), Positives = 221/266 (83%) Query: 1 MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR 60 MI+KCLFPAAGYGTRFLP TK +PKEMLPIV+KPLIQYAVEEA +AG + MAIVTGR KR Sbjct: 1 MIRKCLFPAAGYGTRFLPATKAMPKEMLPIVNKPLIQYAVEEARDAGLQHMAIVTGRGKR 60 Query: 61 SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG 120 +LED+FD S+E+EHQI+GT+KE L+ R +I+ C FSY RQ +MKGLGHAIL+G +LIG Sbjct: 61 ALEDHFDVSFELEHQIRGTDKERYLEGTRELIDTCTFSYTRQVEMKGLGHAILSGRSLIG 120 Query: 121 NEPFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE 180 +EPFAV+LADDLC++ + VL QM LYQ+++CSIVAI+EV E+ KYGVI GE + E Sbjct: 121 DEPFAVVLADDLCLNLEGDGVLAQMIKLYQQFRCSIVAIQEVPREQTQKYGVIAGELIRE 180 Query: 181 GVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR 240 G+Y + MVEKP EDAPSNLA+IGRYILTPDIF+++++T+PGK EIQITDAL QA+ Sbjct: 181 GIYRVNSMVEKPRPEDAPSNLAIIGRYILTPDIFDLIADTEPGKGGEIQITDALMKQAQN 240 Query: 241 KRIIAYQFKGKRYDCGSVEGYIEASN 266 ++AY+FKG+R+DCG EGYIEA+N Sbjct: 241 GCVLAYKFKGQRFDCGGAEGYIEATN 266 Lambda K H 0.318 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 277 Length adjustment: 25 Effective length of query: 248 Effective length of database: 252 Effective search space: 62496 Effective search space used: 62496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate Pf1N1B4_5948 (UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.28864.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-123 397.4 0.0 1.8e-123 397.2 0.0 1.0 1 lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5948 UTP--glucose-1-phosphate uridyly Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5948 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 397.2 0.0 1.8e-123 1.8e-123 1 261 [] 2 264 .. 2 264 .. 0.99 Alignments for each domain: == domain 1 score: 397.2 bits; conditional E-value: 1.8e-123 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedh 64 irk+++PaaG+Gtr+LPatka+Pkemlpiv+kPliqy+veea +aG++++++vtgr+kra+edh lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5948 2 IRKCLFPAAGYGTRFLPATKAMPKEMLPIVNKPLIQYAVEEARDAGLQHMAIVTGRGKRALEDH 65 89************************************************************** PP TIGR01099 65 fDtsyeleaklekknkeellkevrkiaelatilyvrqkeakGLGhavllaeelvgdepfavllg 128 fD+s+ele++++ ++ke++l+ r++++++t+ y+rq e+kGLGha+l +++l+gdepfav+l+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5948 66 FDVSFELEHQIRGTDKERYLEGTRELIDTCTFSYTRQVEMKGLGHAILSGRSLIGDEPFAVVLA 129 **************************************************************** PP TIGR01099 129 Ddlvseeee..alkqlielyektgasiiaveevpkeevskYGvidgeeveeelyevkdlvekPk 190 Ddl+ + e +l+q+i+ly+++++si+a++evp+e+++kYGvi+ge + e +y+v+++vekP+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5948 130 DDLCLNLEGdgVLAQMIKLYQQFRCSIVAIQEVPREQTQKYGVIAGELIREGIYRVNSMVEKPR 193 ****9988778***************************************************** PP TIGR01099 191 peeapsnlaivGrYvltpeifelleetkaGkggeiqltDalrlllekeevlavklkgkryDvGd 254 pe+apsnlai+GrY+ltp+if+l+++t++Gkggeiq+tDal +++++ +vla+k+kg+r+D+G lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5948 194 PEDAPSNLAIIGRYILTPDIFDLIADTEPGKGGEIQITDALMKQAQNGCVLAYKFKGQRFDCGG 257 **************************************************************** PP TIGR01099 255 klgylka 261 ++gy++a lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5948 258 AEGYIEA 264 *****97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (277 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.05 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory