Align protein-Npi-phosphohistidine-sucrose phosphotransferase (EC 2.7.1.211) (characterized)
to candidate Pf1N1B4_836 PTS system, trehalose-specific IIB component (EC 2.7.1.69) / PTS system, trehalose-specific IIC component (EC 2.7.1.69)
Query= BRENDA::P51184 (480 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_836 Length = 480 Score = 447 bits (1149), Expect = e-130 Identities = 218/474 (45%), Positives = 331/474 (69%), Gaps = 9/474 (1%) Query: 2 NYKKSAENILQALGGEDNVEAMTHCATRLRLVLKDEGLVDEKALGDMDVVKGTFSTGGQY 61 +Y +L +LGG DN+E HC TRLRL LKD LVD L +D+VKG+F TGG + Sbjct: 4 DYPNIVTELLHSLGGSDNLEQAAHCVTRLRLALKDPSLVDSATLNQIDLVKGSFYTGGLF 63 Query: 62 QVIIGSGTVNKVFSELEKITGKEASSVSEVKTQGTKNMNPFQRFVKMLSDIFVPIIPAIV 121 QV+IG G V KV++EL + TG S++++VK + ++P QR V++ SD+F+PI+PA++ Sbjct: 64 QVVIGPGEVEKVYAELRRQTGLAVSTIADVKQKSADKIHPMQRLVRVFSDVFMPILPALI 123 Query: 122 AGGLLMGINNILTAPGIFYDNQSLIEVQNQFSGLAEMINIFANAPFTLLPILIGFSAAKR 181 GLLMGINN++ A G+F + ++L++ + GL +IN+ AN F LP L+G+SAAKR Sbjct: 124 IAGLLMGINNLIGAKGMFIEGKTLLDAYPKLDGLWSLINLMANTSFVFLPALVGWSAAKR 183 Query: 182 FGGNAYLGAALGMILVHPELMSAYDYPKALEA--GKEIPHWNLFGL-EINQVGYQGQVLP 238 FGG+ LG LG++LVHP+L++A++Y KA+ G+ +P++++ G+ +I +VGYQGQ+LP Sbjct: 184 FGGSEILGIVLGLMLVHPDLLNAWNYGKAVAGLEGQSLPYFDILGMFQIEKVGYQGQILP 243 Query: 239 MLVATYILATIEKGLRKVIPTVLDNLLTPLLAILSTGFITFSFVGPLTRTLGYWLSDGLT 298 +L+A Y+++ IEK LR +P + L+ P+ I+ TG + + +GP+TR LG +++G+ Sbjct: 244 ILMAAYVMSVIEKWLRARVPNAVQLLVVPITTIVVTGVLALAVIGPVTRHLGILITEGVV 303 Query: 299 WLYEFGGAIGGLIFGLLYAPIVITGMHHSFIAIETQLIADSSSTGGSFIFPIATMSNIAQ 358 L++ +GG IFGLLYAP+VITGMHH F+A++ QLI S+ GG+FI+P+ MSN+AQ Sbjct: 304 TLFDLAPMVGGAIFGLLYAPLVITGMHHMFLAVDLQLI---STQGGTFIWPMIVMSNLAQ 360 Query: 359 GAAALAAFFIIKENKKLKGVASAAGVSALLGITEPAMFGVNLKLRYPFIGAIVGSGIGSA 418 G+AALA F++ + + K +AS + +SA GITEPAMFGVNL+ ++PF A++GS +G Sbjct: 361 GSAALAVFYMTRSVRD-KSMASTSAISAYFGITEPAMFGVNLRYKFPFYAALIGSALGCI 419 Query: 419 YIAFFKVKAIALGTAGIPGFISISGQNNGWLHYGIAMIIAFIVAFGVTYALSYR 472 +++ KV+A A+G G+PGFISI Q + + M+IA +V F +T LS R Sbjct: 420 FLSLNKVQASAIGVGGLPGFISIIPQFIPM--FVVGMVIAMVVPFVLTCGLSMR 471 Lambda K H 0.322 0.140 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 610 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 480 Length of database: 480 Length adjustment: 34 Effective length of query: 446 Effective length of database: 446 Effective search space: 198916 Effective search space used: 198916 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory