Align ABC transporter (characterized, see rationale)
to candidate Pf1N1B4_691 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
Query= uniprot:A0A166QFW2 (381 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_691 Length = 351 Score = 248 bits (633), Expect = 2e-70 Identities = 152/362 (41%), Positives = 210/362 (58%), Gaps = 21/362 (5%) Query: 1 MIKLKLDNVNKQLGGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDL 60 M L L+NV K G ++DV+L + G+ V F+GPSGCGK+TLLR+IAGL+++ GG++ Sbjct: 1 MTGLILENVEKHYGSACAVKDVNLHLPEGKLVCFLGPSGCGKTTLLRMIAGLETLTGGEI 60 Query: 61 LIDGRRVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQI 120 +DG + +R GMVFQS AL+PHM+V +NI++ LKL K + RV++ ++ Sbjct: 61 RLDGEDIGHTPAHQRNFGMVFQSLALFPHMTVGENIAYPLKLRGVSKADQQARVVELLEL 120 Query: 121 LQLDKLLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLH 180 +QL +++ R +LSGGQRQRVA+ RA+A P ILL DEPLS LDA LR M+ EI +L Sbjct: 121 IQLQEMIDRPVAKLSGGQRQRVAIARAIASRPKILLLDEPLSALDAKLRESMQVEIRQLQ 180 Query: 181 DRLGSTMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGS---- 236 RL T I VTHDQ EAMT+AD +VVL RV+QVGSP E+Y PA+ FVA F+GS Sbjct: 181 QRLNITTIMVTHDQREAMTMADIVVVLGEHRVQQVGSPIEIYRHPANEFVADFIGSGNIF 240 Query: 237 PRMNFLSARLQTPGETSLVDTLVWGITSLPFDSSNLAAGTPLSLGIRPEHVSLKAADGTA 296 P + ++ PG +L +P SS + G + + IRPE + L TA Sbjct: 241 PATALGNGKVSLPGGDAL---------QVPICSS-IVVGEKVKMLIRPEDLQLSQPQATA 290 Query: 297 G----VVVTAVEYLGS--ETYVHLETGQDEPLICRCEVSAGWQAGDRVELLLDLDNLHLF 350 G VT V +G+ ET V L C+ G G+ V + L + + Sbjct: 291 GNRLLGKVTFVRDIGATIETTVECSGVSFTALSTPCQ-GVGLSIGNPVSVTLPAEACRVL 349 Query: 351 DA 352 A Sbjct: 350 SA 351 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 351 Length adjustment: 30 Effective length of query: 351 Effective length of database: 321 Effective search space: 112671 Effective search space used: 112671 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory