Align Glycine cleavage system H protein (characterized)
to candidate Pf1N1B4_620 Glycine cleavage system H protein
Query= SwissProt::P0A6T9 (129 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_620 Length = 127 Score = 132 bits (331), Expect = 2e-36 Identities = 64/122 (52%), Positives = 85/122 (69%), Gaps = 1/122 (0%) Query: 6 AELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVK 65 +EL+++++HEWLR EADGT TVGIT AQ LGD+VFV LPE+ + G + A ESVK Sbjct: 2 SELRFTEDHEWLRTEADGTVTVGITAFAQNALGDVVFVQLPEL-QSYDKGAEAATVESVK 60 Query: 66 AASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEAL 125 AAS +Y P+ GE++ VN AL SPELVN +P GW F+ K +D S + LLD AY+ L Sbjct: 61 AASGVYMPLDGEVLEVNPALDSSPELVNEDPLGEGWFFRFKPTDASAVGQLLDQDAYDRL 120 Query: 126 LE 127 ++ Sbjct: 121 IK 122 Lambda K H 0.308 0.127 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 64 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 129 Length of database: 127 Length adjustment: 14 Effective length of query: 115 Effective length of database: 113 Effective search space: 12995 Effective search space used: 12995 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.2 bits) S2: 41 (20.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory