Align LUD_dom domain-containing protein (characterized, see rationale)
to candidate Pf1N1B4_1189 Predicted L-lactate dehydrogenase, hypothetical protein subunit YkgG
Query= uniprot:B2TBY7 (195 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1189 Length = 223 Score = 39.7 bits (91), Expect = 4e-08 Identities = 35/124 (28%), Positives = 49/124 (39%), Gaps = 8/124 (6%) Query: 80 PGTRALTADTEPAS------LQDIDVGVVRARFGVAETGSVWFSEREYVVNALGYIVQHL 133 PG AL A P D + +A TGS+ + + Sbjct: 100 PGLPALKAYDRPVEEWKAELFNDTPASLTTTLGAIAATGSLILWPTREEPRLMSLVPPVH 159 Query: 134 IVLLDPAQLIDGLQDVYRRDDFRDAR--YAALVTGPSATADIEGVLIRGAQGVRSLTVVW 191 LL +++ D V + ++ A LV+GPS TADIE VL GA G + L V+ Sbjct: 160 FALLKASEIRDNFYQVQQEFEWAQGMPTNALLVSGPSKTADIEQVLAYGAHGPKDLVVLI 219 Query: 192 LAAQ 195 L Q Sbjct: 220 LEDQ 223 Lambda K H 0.320 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 68 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 195 Length of database: 223 Length adjustment: 21 Effective length of query: 174 Effective length of database: 202 Effective search space: 35148 Effective search space used: 35148 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory