Align Aconitate-delta-isomerase 1; Itaconic acid/2-hydroxyparaconate biosynthesis cluster protein ADI1; EC 5.-.-.- (characterized)
to candidate Pf1N1B4_4463 FIG00958979: hypothetical protein
Query= SwissProt::A0A0U2X0E4 (443 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4463 Length = 360 Score = 260 bits (665), Expect = 4e-74 Identities = 150/327 (45%), Positives = 198/327 (60%), Gaps = 7/327 (2%) Query: 5 IDTTIYRAGTSRGLYFLASDLPAEPSERDAALISIMGSGHPLQIDGMGGGNSLTSKVAIV 64 I + R GTS+G FLA DLP ERD L+++MGSGH L+IDG+GGG+ TSKVAIV Sbjct: 4 IPCVLMRGGTSKGPVFLAWDLPVSIEERDELLLAVMGSGHELEIDGIGGGSPQTSKVAIV 63 Query: 65 SASTQRSEFDVDYLFCQVGITERFVDTAPNCGNLMSGVAAFAIERGLVQPHPSDTTCLVR 124 S S + DVDYLF QV +++R VDTAPNCGN++ V FAIE+GLV+ T +R Sbjct: 64 SPSLH-PDADVDYLFVQVMVSQRRVDTAPNCGNMLCAVGPFAIEQGLVKAVGELTRVRIR 122 Query: 125 IFNLNSRQASELVIPVYNGRVHYD-DIDDMHMQRPSARVGLRFLDTVGSCTGKLLPTGNA 183 N + S++ P NG+V Y+ D + +A V L FLD GS TGKL PTG+ Sbjct: 123 NLNTGTFVTSDVQTP--NGKVSYEGDTAIDGVPGSAAPVQLTFLDAAGSKTGKLFPTGST 180 Query: 184 SDWIDGLKVSIIDSAVPVVFIRQHDVGITGSEAPATLNANTALLDRLERVRLEAGRRMGL 243 DW D + V+ ID A+P++ I +G G E PA L+A+ + RLE +RL AG MGL Sbjct: 181 QDWFDDIPVTCIDMAMPMLIIEARHLGKRGDETPAELDADKDFMRRLEALRLRAGMAMGL 240 Query: 244 GDVSGSVVPKLSLIGPGTETTTFTARYFTPKACHNAHAVTGAICTAGAAYIDGSVVCEIL 303 GDVS V+PK L+ P T RYF P CH A A+TG+I A A +GSVV ++L Sbjct: 241 GDVSDKVIPKPVLVAPAKAGGTLQVRYFMPHNCHRALAITGSIGLATACVSEGSVVAQML 300 Query: 304 SSRASACSASQRRISIEHPSGVLEVGL 330 + +++ IEHPSG ++V L Sbjct: 301 GNTG---GPRLQQVRIEHPSGGIDVVL 324 Lambda K H 0.318 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 360 Length adjustment: 31 Effective length of query: 412 Effective length of database: 329 Effective search space: 135548 Effective search space used: 135548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory