Align L-threonine dehydratase biosynthetic IlvA; EC 4.3.1.19; Threonine deaminase (uncharacterized)
to candidate Pf1N1B4_4758 Threonine dehydratase biosynthetic (EC 4.3.1.19)
Query= curated2:Q02145 (416 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4758 Length = 337 Score = 231 bits (588), Expect = 3e-65 Identities = 133/311 (42%), Positives = 188/311 (60%), Gaps = 8/311 (2%) Query: 17 VVTKTPLQLDPYLSNKYQANIYLKEENLQKVRSFKLRGAYYSISKLSDEQRSKGVVCASA 76 + +TPLQ P LS I LK E+LQ SFK+RGAY + LSDE +++GV+ ASA Sbjct: 26 LAVRTPLQAAPALSEALGNQILLKREDLQPTFSFKIRGAYNKLVNLSDEHKARGVITASA 85 Query: 77 GNHAQGVAFAANQLNISATIFMPVTTPNQKISQVKFFGESHVTIRLIGDTFDESARAAKA 136 GNHAQGVA AA +L I ATI MP TTP K+ V+ G + L G++F + A + Sbjct: 86 GNHAQGVALAARELGIGATIVMPCTTPELKVHGVRSRGAEAL---LHGESFPFALEYALS 142 Query: 137 FSQDNDKPFIDPFDDENVIAGQGTVALEIFAQAKKQGISLDKIFVQIGGGGLIAGITAYS 196 +Q + F+ PFDD +VIAGQGTVA+EI Q QG LD IFV +GGGGLIAGI AY+ Sbjct: 143 LAQQTGRTFVSPFDDPDVIAGQGTVAMEILRQ--HQG-PLDAIFVPVGGGGLIAGIAAYA 199 Query: 197 KERYPQTEIIGVEAKGATSMKAAYSAGQPVTLEHIDKFADGIAVATVGQKTYQLINDKVK 256 K P+ IIGVE++ + ++AA AG+ V L + FADG+AVA +G +++ V Sbjct: 200 KYLRPEIRIIGVESEHSACLQAALRAGERVVLPTVGTFADGVAVAQIGAYGFEICRFCVD 259 Query: 257 QLLAVDEGLISQTILELYSKLGIVAEPAGATSVAALE--LIKDEIKGKNIVCIISGGNND 314 ++L V + I +Y + EP+GA +VA ++ + + +G+ +V I SG N + Sbjct: 260 EVLTVSNDELCAAIKNIYDDTRSITEPSGALAVAGIKQYVARTGARGQTLVAIDSGANIN 319 Query: 315 ISRMQEIEERA 325 ++ + ERA Sbjct: 320 FDSLRHVAERA 330 Lambda K H 0.317 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 337 Length adjustment: 30 Effective length of query: 386 Effective length of database: 307 Effective search space: 118502 Effective search space used: 118502 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate Pf1N1B4_4758 (Threonine dehydratase biosynthetic (EC 4.3.1.19))
to HMM TIGR01124 (ilvA: threonine ammonia-lyase, biosynthetic (EC 4.3.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01124.hmm # target sequence database: /tmp/gapView.14302.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01124 [M=499] Accession: TIGR01124 Description: ilvA_2Cterm: threonine ammonia-lyase, biosynthetic Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-153 497.4 0.7 2.5e-153 497.2 0.7 1.0 1 lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4758 Threonine dehydratase biosynthet Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4758 Threonine dehydratase biosynthetic (EC 4.3.1.19) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 497.2 0.7 2.5e-153 2.5e-153 2 320 .. 14 332 .. 13 335 .. 0.99 Alignments for each domain: == domain 1 score: 497.2 bits; conditional E-value: 2.5e-153 TIGR01124 2 ylrailkarvyeaavetplekaaklserlknrvllkredlqpvfsfklrGaynkmaqlsaeqka 65 y+++il a vye av tpl+ a lse l+n++llkredlqp fsfk+rGaynk+ +ls+e+ka lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4758 14 YVKKILAAPVYELAVRTPLQAAPALSEALGNQILLKREDLQPTFSFKIRGAYNKLVNLSDEHKA 77 899************************************************************* PP TIGR01124 66 kGviaasaGnhaqGvalsakklGvkavivmpettpeikvdavkafGgevvlhGenydeakakal 129 +Gvi+asaGnhaqGval+a++lG+ a+ivmp+ttpe+kv+ v+++G+e +lhGe++ a ++al lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4758 78 RGVITASAGNHAQGVALAARELGIGATIVMPCTTPELKVHGVRSRGAEALLHGESFPFALEYAL 141 **************************************************************** PP TIGR01124 130 elaqekgltfiapfddplviaGqGtvalellrqveedldavfvpvGGGGliaGvaalvkqllpe 193 laq+ g tf++pfddp+viaGqGtva+e+lrq++ +lda+fvpvGGGGliaG+aa+ k l+pe lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4758 142 SLAQQTGRTFVSPFDDPDVIAGQGTVAMEILRQHQGPLDAIFVPVGGGGLIAGIAAYAKYLRPE 205 **************************************************************** PP TIGR01124 194 ikvigveaedsaalkqaleaGervkldqvGlfadGvavkevGdetfrlckeylddivlvdtdev 257 i++igve+e sa+l++al aGerv l +vG fadGvav ++G++ f++c+ +d++++v de+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4758 206 IRIIGVESEHSACLQAALRAGERVVLPTVGTFADGVAVAQIGAYGFEICRFCVDEVLTVSNDEL 269 **************************************************************** PP TIGR01124 258 caaikdvfedtravlepaGalalaGlkkyvakkgiedktlvailsGanlnfdrlryvserael 320 caaik++++dtr+++ep+Gala+aG+k+yva+ g++++tlvai sGan+nfd+lr+v+era l lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4758 270 CAAIKNIYDDTRSITEPSGALAVAGIKQYVARTGARGQTLVAIDSGANINFDSLRHVAERAAL 332 ************************************************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (499 nodes) Target sequences: 1 (337 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 6.62 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory