Align L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 (characterized)
to candidate Pf1N1B4_2461 Threonine dehydrogenase and related Zn-dependent dehydrogenases
Query= SwissProt::Q8U259 (348 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2461 Length = 399 Score = 102 bits (253), Expect = 2e-26 Identities = 82/281 (29%), Positives = 132/281 (46%), Gaps = 45/281 (16%) Query: 32 VLIKILATSICGTDLHIYEWNEWAQTRIRPPQIMGHEVAGEVVEVGPGVEGIEVGDYVSV 91 V++++++T+ICG+D H+ AQT + ++GHE+ GEV+E G GVE +++GD VSV Sbjct: 37 VILRVVSTNICGSDQHMVRGRTTAQTGL----VLGHEITGEVIEKGSGVENLQIGDLVSV 92 Query: 92 ETHIVCGKCYACKRGQYHVCQNTK------IFGV----DTDGVFAEYAVVPAQNVWKNPK 141 ++ CG+C +CK VC + +G D G AEYA VP + N Sbjct: 93 PFNVACGRCRSCKEQHTGVCLSVNPARPGGAYGYVDMGDWTGGQAEYAFVPYADF--NLL 150 Query: 142 NIPPEYATLQE-----PLGNAVDT-----VLAGPIAGKSVLITGAGPLGLLGIAVAKASG 191 +P +++ L + + T V AG G +V I GAGP+GL A A+ G Sbjct: 151 KLPDRDRAMEKIRDLTCLSDILPTGYHGAVTAGVGPGSTVYIAGAGPVGLAAAASARLLG 210 Query: 192 AYPVIVSEPSEFRRNLAKKVGADYVINPFEEDVVKEVMDITDGNGVDVFLEFSG------ 245 A VI+ + + R AK G + + + +++ + VD ++ G Sbjct: 211 AAVVIIGDVNPIRLAHAKAQGFEIADLSTDTPLHEQIAALLGEPEVDCAVDAVGFEARGH 270 Query: 246 --------APKALEQGLQAVT-PAGRVSLLGLF----PGKV 273 AP + L V AG++ + GL+ PG V Sbjct: 271 GHAGVKHEAPATVLNSLMGVVRVAGKIGIPGLYVTEDPGAV 311 Lambda K H 0.318 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 399 Length adjustment: 30 Effective length of query: 318 Effective length of database: 369 Effective search space: 117342 Effective search space used: 117342 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory