Align Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24) (characterized)
to candidate Pf1N1B4_3238 Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)
Query= reanno::pseudo3_N2E3:AO353_17230 (266 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3238 Length = 268 Score = 462 bits (1189), Expect = e-135 Identities = 231/267 (86%), Positives = 247/267 (92%), Gaps = 5/267 (1%) Query: 1 VGFVQLADGELKYQ-----LDGPEHAPVLVLSNSLGTNLHMWDVQIPAFTKHFRVLRFDT 55 V FVQLA+GEL YQ LDGP APVLVLSNSLGT+LHMWD QIPAFT+HFRVLRFDT Sbjct: 1 VAFVQLAEGELHYQIQGPQLDGPADAPVLVLSNSLGTDLHMWDAQIPAFTEHFRVLRFDT 60 Query: 56 RGHGRSLVTPGPYSIEQLGRDVLALLDALNIERAHFCGLSMGGLIGQWLGINAGERLHKL 115 RGHG+SLVTPGPYSIEQLGRDVLALLDAL+IERAHFCGLSMGGLIGQWLGINA +RL+KL Sbjct: 61 RGHGQSLVTPGPYSIEQLGRDVLALLDALHIERAHFCGLSMGGLIGQWLGINASQRLNKL 120 Query: 116 VVCNTAAKIGDPSVWNPRIETVLRDGPAAMVALRDASIARWFTPDFAQANPAVAKQITDM 175 +VCNTAAKIGDPSVWNPRIETVLRDG AAMVALRDASIARWFT DFA+ANPA K+ITDM Sbjct: 121 IVCNTAAKIGDPSVWNPRIETVLRDGSAAMVALRDASIARWFTADFAEANPAAVKRITDM 180 Query: 176 LAATSPQGYAANCAAVRDADFREQLASITVPTLVIAGTEDAVTPPSGGRFIQERVRGAEY 235 LAATSP+GYAANCAAVRDADFR+QL+SI VP LVIAGTEDAVTPPSGG FIQE V+GAEY Sbjct: 181 LAATSPEGYAANCAAVRDADFRDQLSSIKVPLLVIAGTEDAVTPPSGGHFIQEHVQGAEY 240 Query: 236 AEFYAAHLSNVQAGSAFSDRVLSFLLA 262 AEFYAAHLSNVQAG+AFSDRVL+FL A Sbjct: 241 AEFYAAHLSNVQAGAAFSDRVLAFLSA 267 Lambda K H 0.321 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 268 Length adjustment: 25 Effective length of query: 241 Effective length of database: 243 Effective search space: 58563 Effective search space used: 58563 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate Pf1N1B4_3238 (Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24))
to HMM TIGR02427 (pcaD: 3-oxoadipate enol-lactonase (EC 3.1.1.24))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02427.hmm # target sequence database: /tmp/gapView.4363.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02427 [M=251] Accession: TIGR02427 Description: protocat_pcaD: 3-oxoadipate enol-lactonase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-108 346.0 0.1 6.7e-108 345.8 0.1 1.0 1 lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3238 Beta-ketoadipate enol-lactone hy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3238 Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 345.8 0.1 6.7e-108 6.7e-108 2 250 .. 11 265 .. 10 266 .. 0.97 Alignments for each domain: == domain 1 score: 345.8 bits; conditional E-value: 6.7e-108 TIGR02427 2 lhyrlegae....adkpvlvlinSLGtdlrlwdkvlealtkdfrvlryDkrGHGlSdvpegpys 61 lhy+++g++ ad+pvlvl+nSLGtdl++wd++++a+t++frvlr+D+rGHG+S v+ gpys lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3238 11 LHYQIQGPQldgpADAPVLVLSNSLGTDLHMWDAQIPAFTEHFRVLRFDTRGHGQSLVTPGPYS 74 7888776653333499************************************************ PP TIGR02427 62 iedladdvlallDalgiekaavcGlSlGGliaqaLaarrpdrvealvlsntaakigtaesWeaR 125 ie+l++dvlallDal+ie+a++cGlS+GGli+q+L++++++r+++l+++ntaakig++++W++R lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3238 75 IEQLGRDVLALLDALHIERAHFCGLSMGGLIGQWLGINASQRLNKLIVCNTAAKIGDPSVWNPR 138 **************************************************************** PP TIGR02427 126 iaavraeG...laaladavlerwFtpafreaepaelelvrnmlveqppegYaatcaAirdadlr 186 i++v ++G + al+da+++rwFt++f+ea+pa+++ +++ml++++pegYaa+caA+rdad+r lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3238 139 IETVLRDGsaaMVALRDASIARWFTADFAEANPAAVKRITDMLAATSPEGYAANCAAVRDADFR 202 ********999999************************************************** PP TIGR02427 187 erleeiavPtlviaGdeDgstPpelvreiadlvpgarfaeieeaaHlpnleqpeafaallrdfl 250 ++l++i+vP+lviaG+eD++tPp+ + i+++v ga++ae++ aaHl+n+++++af++++ +fl lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3238 203 DQLSSIKVPLLVIAGTEDAVTPPSGGHFIQEHVQGAEYAEFY-AAHLSNVQAGAAFSDRVLAFL 265 ******************************************.********************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (251 nodes) Target sequences: 1 (268 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.64 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory