Align Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 (characterized)
to candidate Pf1N1B4_1055 Phosphate acetyltransferase (EC 2.3.1.8)
Query= SwissProt::P77844 (329 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1055 Length = 422 Score = 266 bits (681), Expect = 5e-76 Identities = 143/330 (43%), Positives = 206/330 (62%), Gaps = 5/330 (1%) Query: 1 MSAELFENWLLKRARAEHSHIVLPEGDDDRILMAAHQLLDQDICDITILGDPVKIKERAT 60 +S +F L++RA+A + IVLPEG + + AA + I +L P ++ A Sbjct: 92 LSPAVFRYQLIQRAQAANKRIVLPEGSEPLTVQAAAICQARGIARCVLLAKPADVEAVAR 151 Query: 61 ELGLHLNTAYLVNPLTDPRL--EEFAEQFAELRKSKSVTIDEAREIMKDISYFGTMMVHN 118 G+ L + DP L E + E LRK+KS+ A + ++D GTMM+ Sbjct: 152 AQGIELPPGL---EILDPDLIRERYVEPMVALRKTKSLNAPMAEQQLEDTVVIGTMMLAL 208 Query: 119 GDADGMVSGAANTTAHTIKPSFQIIKTVPEASVVSSIFLMVLRGRLWAFGDCAVNPNPTA 178 + DG+VSG ++TA+TI+P+ Q+IKT P ++VSS+F M+ + +GDC +NP+P+A Sbjct: 209 DEVDGLVSGVIHSTANTIRPALQLIKTAPGCTLVSSVFFMLFPEEVLVYGDCVMNPHPSA 268 Query: 179 EQLGEIAVVSAKTAAQFGIDPRVAILSYSTGNSGGGSDVDRAIDALAEARRLNPELCVDG 238 +L EIA+ SA +AA FGI PRVA++SYS+G S G +V++ +A A L +DG Sbjct: 269 SELAEIALQSADSAAAFGITPRVAMISYSSGESASGEEVEKVREATLLAHEQQNSLLIDG 328 Query: 239 PLQFDAAVDPGVARKKMPDSDVAGQANVFIFPDLEAGNIGYKTAQRTGHALAVGPILQGL 298 PLQ+DAA + VAR+ P+S VAG+A VF+FPDL GN +K QR+ +++GP+LQGL Sbjct: 329 PLQYDAAANETVARQLAPNSQVAGRATVFVFPDLNTGNTTHKAVQRSADCVSLGPMLQGL 388 Query: 299 NKPVNDLSRGATVPDIVNTVAITAIQAGGR 328 KPVNDL RGA V DIV T+A+TAIQA R Sbjct: 389 RKPVNDLPRGAQVDDIVYTIALTAIQAANR 418 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 422 Length adjustment: 30 Effective length of query: 299 Effective length of database: 392 Effective search space: 117208 Effective search space used: 117208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate Pf1N1B4_1055 (Phosphate acetyltransferase (EC 2.3.1.8))
to HMM TIGR00651 (pta: phosphate acetyltransferase (EC 2.3.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00651.hmm # target sequence database: /tmp/gapView.1392.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00651 [M=304] Accession: TIGR00651 Description: pta: phosphate acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-118 380.9 0.0 3.2e-118 380.6 0.0 1.1 1 lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1055 Phosphate acetyltransferase (EC Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1055 Phosphate acetyltransferase (EC 2.3.1.8) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 380.6 0.0 3.2e-118 3.2e-118 1 304 [] 112 412 .. 112 412 .. 0.98 Alignments for each domain: == domain 1 score: 380.6 bits; conditional E-value: 3.2e-118 TIGR00651 1 ivlPEgseervlkAaallaekkiaekvllvnkeeevkn.kakevnlklgkvvvedpdvskdiek 63 ivlPEgse+ +++Aaa+++ ++ia++vll++ ++++++ +a++++l g +++ dpd+ +e+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1055 112 IVLPEGSEPLTVQAAAICQARGIARCVLLAKPADVEAVaRAQGIELPPG-LEILDPDLI--RER 172 8************************************978999999876.678889998..8** PP TIGR00651 64 yverlyekrkhkGvtekeareqlrDevslaallvelgeadglvsGavsttaktlrpalqiiktl 127 yve ++ +rk+k ++ +a++ql+D+v++++++++l+e+dglvsG ++ta+t+rpalq+ikt+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1055 173 YVEPMVALRKTKSLNAPMAEQQLEDTVVIGTMMLALDEVDGLVSGVIHSTANTIRPALQLIKTA 236 **************************************************************** PP TIGR00651 128 egvklvssvfimekeeevlvfaDCavavdPnaeeLAeiAlqsaksakslgeeepkvallsystk 191 +g lvssvf+m +eevlv++DC ++++P+a eLAeiAlqsa+sa ++g + p+va++sys++ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1055 237 PGCTLVSSVFFMLFPEEVLVYGDCVMNPHPSASELAEIALQSADSAAAFG-ITPRVAMISYSSG 299 **************************************************.************* PP TIGR00651 192 gsgkgeevekvkeAvkilkekepdllldGelqfDaAlvekvaekkapesevagkanvfvFPdLd 255 s++geevekv+eA+ +++e++ ll+dG+lq+DaA e+va++ ap+s+vag+a+vfvFPdL+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1055 300 ESASGEEVEKVREATLLAHEQQNSLLIDGPLQYDAAANETVARQLAPNSQVAGRATVFVFPDLN 363 **************************************************************** PP TIGR00651 256 aGnigYkivqRladaeaiGPilqGlakPvnDLsRGasvedivnvviita 304 +Gn++ k+vqR+ad ++GP+lqGl+kPvnDL RGa+v+div+++++ta lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1055 364 TGNTTHKAVQRSADCVSLGPMLQGLRKPVNDLPRGAQVDDIVYTIALTA 412 ***********************************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (422 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.10 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory