Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate Pf1N1B4_1955 Glutathione S-transferase, unnamed subgroup (EC 2.5.1.18)
Query= reanno::pseudo5_N2C3_1:AO356_16835 (211 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1955 Length = 208 Score = 70.9 bits (172), Expect = 2e-17 Identities = 59/199 (29%), Positives = 92/199 (46%), Gaps = 8/199 (4%) Query: 1 MELYTYYRSTSSYRVRIALALKGLDYQALPVNLIAAPGGEHRQPAYLAINPQGRVPALRT 60 ++LY + RS ++RV + LAL L + + V+L G H+Q +LA+NP G+VP + Sbjct: 4 IKLYNFPRSGHAHRVELMLALLQLPTELIFVDLAK---GAHKQADFLALNPFGQVPVI-D 59 Query: 61 DEGALLVQSPAIIEYLEERYPQVPLLSADLAVRAHERGVAALIGCDIHPLHNVSVLNQLR 120 D+G +L S AI+ YL +Y L D A + ++ I + L + Sbjct: 60 DQGVVLADSNAILVYLALKYGNGRWLPTDPVGAAKVQRWLSVAAGPIAFGPGRARLITVF 119 Query: 121 QWGHDEAQVTEWIGHWISQGLAAVEQLIGDDGYCFGALPGLADVFLIPQLYAAERFNVSL 180 ++ +V + W L ++Q +G Y G P +AD+ + A NVSL Sbjct: 120 GAPYNAQEVIAYAHSW----LKVIDQELGATAYLAGGEPTIADIAAYSYIAHAPEGNVSL 175 Query: 181 QGYPRIRRVAALAAVHPAF 199 YP IR A V P F Sbjct: 176 DDYPNIRAWLARVEVLPGF 194 Lambda K H 0.321 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 211 Length of database: 208 Length adjustment: 21 Effective length of query: 190 Effective length of database: 187 Effective search space: 35530 Effective search space used: 35530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory