Align Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; EC 2.3.1.168; Branched-chain alpha-keto acid dehydrogenase complex component E2; BCKAD-E2; BCKADE2; Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; Dihydrolipoamide branched chain transacylase; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (uncharacterized)
to candidate Pf1N1B4_3682 Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)
Query= curated2:P37942 (424 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3682 Length = 405 Score = 253 bits (647), Expect = 6e-72 Identities = 159/419 (37%), Positives = 237/419 (56%), Gaps = 27/419 (6%) Query: 1 MAIEQMTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKVNAEVPSSFTGTITEL 60 MAIE + P ESV +GT++ W PGD V + + I ++ TDKV EV ++ G + + Sbjct: 1 MAIE-IKAPTFPESVADGTVATWHKKPGDAVKRDELIVDIETDKVVLEVLATADGVLGAI 59 Query: 61 VGEEGQTLQVGEMICKIETEGANPAEQKQEQPAASEAAENPVAKSAGAADQPNKKRYSPA 120 V EG T+ E++ I EG+ A AA AA P A +A A + +PA Sbjct: 60 VKNEGDTVLSDEVLGSIG-EGSAAA-------AAPAAAAAPAAAAAPAEAGEDDPVAAPA 111 Query: 121 VLRLAGEHGIDLDQVTGTGAGGRITRKDIQRLIETGGVQEQNPEELKTAAPAPKSASKPE 180 +LA E+GI++ V GTG GGR+T++D+ + K AAPA A Sbjct: 112 ARKLAEENGINIASVAGTGKGGRVTKEDVVAAVAA-----------KKAAPAAAPAKAAA 160 Query: 181 PKEETSYPASAAGD---KEIPVTGVRKAIASNMKRSKTEIPHAWTMMEVDVTNMVAYRNS 237 P + P AAGD K +P+T VR +A + +++ + T EVD+T ++A R+ Sbjct: 161 PA--AAAPVFAAGDRIEKRVPMTRVRATVAKRLVEAQSNMAMLTTFNEVDMTEVMALRSK 218 Query: 238 IKDSFKKTE-GFNLTFFAFFVKAVAQALKEFPQMNSMWAGDKIIQKKDINISIAVATEDS 296 KD F+K+ G L F +FFVKA +ALK FP +N+ G I+ ++ +AV+++ Sbjct: 219 YKDLFEKSHNGVRLGFMSFFVKAATEALKRFPAVNASIDGADIVYHGYADVGVAVSSDRG 278 Query: 297 LFVPVIKNADEKTIKGIAKDITGLAKKVRDGKLTADDMQGGTFTVNNTGSFGSVQSMGII 356 L VPV++NA+ ++ I I KK RDGKL+ D+M GGTFT+ N G+FGS+ S I+ Sbjct: 279 LVVPVLRNAELMSLAEIEGGIATFGKKARDGKLSMDEMTGGTFTITNGGTFGSMMSTPIV 338 Query: 357 NYPQAAILQVESIVKRPVVMDNGMIAVRDMVNLCLSLDHRVLDGLVCGRFLGRVKQILE 415 N PQAAIL + +I++RP+ + NG + +R M+ L LS DHR++DG FL +K +LE Sbjct: 339 NPPQAAILGMHNILQRPMAI-NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLE 396 Lambda K H 0.312 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 405 Length adjustment: 31 Effective length of query: 393 Effective length of database: 374 Effective search space: 146982 Effective search space used: 146982 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory