Align 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (characterized)
to candidate Pf1N1B4_1228 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)
Query= reanno::pseudo13_GW456_L13:PfGW456L13_5145 (295 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1228 Length = 295 Score = 562 bits (1448), Expect = e-165 Identities = 287/295 (97%), Positives = 290/295 (98%) Query: 1 MKIAFIGLGNMGAPMARNLIKAGHALRLVDLNKAVLAELEQLGGSISASAREAAEGAELV 60 MKIAFIGLGNMGAPMARNLIKAGH+LRLVDLNKAVLAELEQLGGSISASAREAA+GAELV Sbjct: 1 MKIAFIGLGNMGAPMARNLIKAGHSLRLVDLNKAVLAELEQLGGSISASAREAAQGAELV 60 Query: 61 ITMLPAAVHVRSVWLGEDGVLAGIGKGVPAVDCSTIDPQTARDVAAAAAKQGVAMADAPV 120 ITMLPAAVHVRSVWLGEDGVLAGI KGVPAVDCSTIDPQTARDVAAAAAKQGV MADAPV Sbjct: 61 ITMLPAAVHVRSVWLGEDGVLAGIAKGVPAVDCSTIDPQTARDVAAAAAKQGVVMADAPV 120 Query: 121 SGGTGGAAAGTLTFMVGATPELFATLQPVLAQMGRNIVHCGEVGTGQIAKICNNLLLGIS 180 SGGTGGAAAGTLTFMVGATPELFATLQPVLAQMGRNIVHCGEVGTGQIAKICNNLLLGIS Sbjct: 121 SGGTGGAAAGTLTFMVGATPELFATLQPVLAQMGRNIVHCGEVGTGQIAKICNNLLLGIS 180 Query: 181 MVGVSEAMALGDALGIDTKVLAGIINSSTGRCWSSEMYNPWPGIVETAPASRGYTGGFGA 240 MVGVSEAMALGDALGIDT VLAGIINSSTGRCWSSEMYNPWPGIVETAPASRGYTGGFGA Sbjct: 181 MVGVSEAMALGDALGIDTTVLAGIINSSTGRCWSSEMYNPWPGIVETAPASRGYTGGFGA 240 Query: 241 ELMLKDLGLATEAARQAHQPVVLGAVAQQLYQAMSLRGEGGQDFSAIINGYRKPQ 295 ELMLKDLGLATEAARQAHQPVVLGAVAQQLYQAMS RGEGG+DFSAIIN YRKPQ Sbjct: 241 ELMLKDLGLATEAARQAHQPVVLGAVAQQLYQAMSQRGEGGKDFSAIINSYRKPQ 295 Lambda K H 0.317 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 295 Length adjustment: 26 Effective length of query: 269 Effective length of database: 269 Effective search space: 72361 Effective search space used: 72361 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate Pf1N1B4_1228 (3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31))
to HMM TIGR01692 (mmsB: 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01692.hmm # target sequence database: /tmp/gapView.6681.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01692 [M=288] Accession: TIGR01692 Description: HIBADH: 3-hydroxyisobutyrate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-134 433.7 8.5 1.9e-134 433.5 8.5 1.0 1 lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1228 3-hydroxyisobutyrate dehydrogena Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1228 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 433.5 8.5 1.9e-134 1.9e-134 1 288 [] 5 292 .. 5 292 .. 1.00 Alignments for each domain: == domain 1 score: 433.5 bits; conditional E-value: 1.9e-134 TIGR01692 1 fiGlGnmGgpmaanllkaghavrvfdlsakaveelveaGaqaaasaaeaveeadvvitmlPagk 64 fiGlGnmG+pma+nl+kagh++r+ dl+ +++ el + G +++asa ea+++a+ vitmlPa+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1228 5 FIGLGNMGAPMARNLIKAGHSLRLVDLNKAVLAELEQLGGSISASAREAAQGAELVITMLPAAV 68 9*************************************************************** PP TIGR01692 65 hvesvyagdegilakvkkksllidsstidvdsarkvaeeaaakGavfldaPvsGGvggaraGtl 128 hv+sv++g++g+la ++k+++ +d+stid+++ar va++aa++G v++daPvsGG+gga+aGtl lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1228 69 HVRSVWLGEDGVLAGIAKGVPAVDCSTIDPQTARDVAAAAAKQGVVMADAPVSGGTGGAAAGTL 132 **************************************************************** PP TIGR01692 129 tfmvGgeaeefaraepvleamgknivhaGdaGaGqaakiCnnlllgismiGvaealalgeklGl 192 tfmvG++ e fa +pvl++mg+nivh+G++G+Gq akiCnnlllgism+Gv+ea+alg +lG+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1228 133 TFMVGATPELFATLQPVLAQMGRNIVHCGEVGTGQIAKICNNLLLGISMVGVSEAMALGDALGI 196 **************************************************************** PP TIGR01692 193 dpkvlaeilskssGrcWsldtynPvPGvveqaPasngykgGfatalmlkdlglaqeaaksvkas 256 d+ vla i++ s+GrcWs+++ynP+PG+ve+aPas+gy+gGf+++lmlkdlgla eaa++++++ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1228 197 DTTVLAGIINSSTGRCWSSEMYNPWPGIVETAPASRGYTGGFGAELMLKDLGLATEAARQAHQP 260 **************************************************************** PP TIGR01692 257 vllGalarelyslfaskgagkkdfsavikllr 288 v+lGa+a++ly++++++g g+kdfsa+i+ +r lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1228 261 VVLGAVAQQLYQAMSQRGEGGKDFSAIINSYR 292 *****************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (288 nodes) Target sequences: 1 (295 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.62 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory