Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate Pf1N1B4_3659 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)
Query= SwissProt::P28811 (298 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3659 Length = 256 Score = 134 bits (336), Expect = 3e-36 Identities = 81/233 (34%), Positives = 122/233 (52%), Gaps = 7/233 (3%) Query: 41 VEQGAQGADSALQCCEGAEVVISMLPAGQHVESLYLGDDGLLARVAGKPLLIDCSTIAPE 100 V GA + + + AE +I M+P V+ + DG+ A V+ ++ID S+I+P Sbjct: 1 VAAGAVALANPKEVAQEAEFIIVMVPDTPQVDDVLFRADGVAAGVSKGKVVIDMSSISPT 60 Query: 101 TARKVAEAAAAKGLTLLDAPVSGGVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFH 160 + A KG LDAPVSGG GA+A TLS +VGG A+ F RA P+ + MG+NI Sbjct: 61 ATKAFAAKINEKGAQYLDAPVSGGEVGAKAATLSIMVGGDADAFERALPLFQAMGKNITL 120 Query: 161 AGDHGAGQVAKICNNMLLGILMAGTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYN 220 G +G GQ AK+ N +++ + + AEAL KNG DPA + E + + L ++ Sbjct: 121 VGGNGDGQTAKVANQIIVALNIQAVAEALLFASKNGADPAKVREALMGGFASSKILEVHG 180 Query: 221 PWPGVMPQAPASNGYAGGFQVRLMNKDLGLALANAQAVQASTPLGALARNLFS 273 + + GF++ L KDL LALA A+ + + P A + +FS Sbjct: 181 -------ERMIKGTFDPGFRISLHQKDLNLALAGARELGINLPNTANTQQVFS 226 Lambda K H 0.317 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 256 Length adjustment: 25 Effective length of query: 273 Effective length of database: 231 Effective search space: 63063 Effective search space used: 63063 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory