Align 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (characterized)
to candidate Pf1N1B4_5077 D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)
Query= reanno::psRCH2:GFF2390 (296 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5077 Length = 301 Score = 160 bits (405), Expect = 3e-44 Identities = 99/289 (34%), Positives = 147/289 (50%), Gaps = 9/289 (3%) Query: 2 HIGFIGLGNMGAPMAHNLLKAGHQLSVFDLNAAAVENLVGAGALPVDSPTAIAQGNAELI 61 ++G +GLG MG +A +LL++G + D+ AA E G G + SP +A ++I Sbjct: 5 NVGVVGLGAMGLGIARSLLRSGFNVHACDVRAAVTEQFAGEGGVACSSPAHMA-AECDVI 63 Query: 62 ITMLPAAAHVKGVYLGVNGLIAHSRAGVMLIDCSTIDPHSAREVAKAAAEHGNPMLDAPV 121 IT++ A + V G G +A R G ++I C+T+ P A ++ + G LDAP+ Sbjct: 64 ITVVVNAEQTETVLFGEGGAVAALRPGSLVIGCATVAPTYAVDLGQRLTAQGLLYLDAPI 123 Query: 122 SGGTGGAAAGTLTFMVGGSDPDFDHAQPILAAMGKNIVHCG-AAGNGQVAKVANNMLLGI 180 SGG AAAG +T M G + A+ +LA M + G G G K+ N +L G+ Sbjct: 124 SGGAAKAAAGEMTMMTSGPADAYAKAEAVLAGMAGKVYRLGDTHGLGSKVKIINQLLAGV 183 Query: 181 SMIGVAEAMALGVALGMDAKTLAGVINTSSGRCWSSDTYNPFPGVLDNVPSSRGYSGGFG 240 + AEAMALG+ G+DA L VI S+G W + P D P S Sbjct: 184 HIAASAEAMALGLREGVDADALYEVITHSAGNSWMFENRVPHILKADYTPLS-------A 236 Query: 241 SDLMLKDLGLATEAAKQVRQPVILGALAQQLYQSFSAQGHGGLDFSAII 289 D+ +KDLGL + A+ + P+ L A A Q++ S+ G G D SA+I Sbjct: 237 VDIFVKDLGLVLDTARASKFPLPLSATAHQMFMQASSAGFGREDDSAVI 285 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 301 Length adjustment: 27 Effective length of query: 269 Effective length of database: 274 Effective search space: 73706 Effective search space used: 73706 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory