Align Methylisocitrate lyase (EC 4.1.3.30) (characterized)
to candidate Pf1N1B4_3819 Methylisocitrate lyase (EC 4.1.3.30)
Query= reanno::pseudo6_N2E2:Pf6N2E2_6061 (294 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3819 Length = 296 Score = 560 bits (1444), Expect = e-164 Identities = 287/293 (97%), Positives = 291/293 (99%) Query: 2 SNSTPGQRFRDAVANEHPLQVVGTINANHALLAKRAGFKAIYLSGGGVAAGSLGVPDLGI 61 + STPGQRFRDAVA+EHPLQVVGTINANHALLAKRAGFKAIYLSGGGVAAGSLGVPDLGI Sbjct: 4 NKSTPGQRFRDAVASEHPLQVVGTINANHALLAKRAGFKAIYLSGGGVAAGSLGVPDLGI 63 Query: 62 TGLDDVLTDVRRITDVCDLPLLVDVDTGFGSSAFNVARTVKSMIKFGAAAIHIEDQVGAK 121 TGLDDVLTDVRRITDVCDLPLLVDVDTGFGSSAFNVARTVKSMIKFGAAAIHIEDQVGAK Sbjct: 64 TGLDDVLTDVRRITDVCDLPLLVDVDTGFGSSAFNVARTVKSMIKFGAAAIHIEDQVGAK 123 Query: 122 RCGHRPNKEIVSQQEMVDRIKAAVDARTDDSFVIMARTDALAVEGLESALDRAAACIEAG 181 RCGHRPNKEIV+QQEMVDRIKAAVDARTDDSFVIMARTDALAVEGLESALDRAAACIEAG Sbjct: 124 RCGHRPNKEIVTQQEMVDRIKAAVDARTDDSFVIMARTDALAVEGLESALDRAAACIEAG 183 Query: 182 ADMIFPEAITELEMYKLFASRVKAPILANITEFGATPLYTTEQLAGADVSLVLYPLSAFR 241 ADM+FPEAITELEMYKLFASRVKAPILANITEFGATPLYTTEQLA ADVSLVLYPLSAFR Sbjct: 184 ADMVFPEAITELEMYKLFASRVKAPILANITEFGATPLYTTEQLAAADVSLVLYPLSAFR 243 Query: 242 AMNKAAENVYTAIRRDGTQQNVIDTMQTRMELYDRIDYHTFEQKLDALFAAKK 294 AMNKAAENVYTAIRRDGTQQNVIDTMQTRMELYDRIDYHTFEQKLDALFAAKK Sbjct: 244 AMNKAAENVYTAIRRDGTQQNVIDTMQTRMELYDRIDYHTFEQKLDALFAAKK 296 Lambda K H 0.320 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 296 Length adjustment: 26 Effective length of query: 268 Effective length of database: 270 Effective search space: 72360 Effective search space used: 72360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate Pf1N1B4_3819 (Methylisocitrate lyase (EC 4.1.3.30))
to HMM TIGR02317 (prpB: methylisocitrate lyase (EC 4.1.3.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02317.hmm # target sequence database: /tmp/gapView.7731.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02317 [M=285] Accession: TIGR02317 Description: prpB: methylisocitrate lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-134 434.1 2.3 1.2e-134 433.9 2.3 1.0 1 lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3819 Methylisocitrate lyase (EC 4.1.3 Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3819 Methylisocitrate lyase (EC 4.1.3.30) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 433.9 2.3 1.2e-134 1.2e-134 2 284 .. 9 293 .. 8 294 .. 0.99 Alignments for each domain: == domain 1 score: 433.9 bits; conditional E-value: 1.2e-134 TIGR02317 2 gkalrellkkedilqipGainalvallaekaGfeavYlsGaalaa.slglPDlglttleevaee 64 g+++r+++++e++lq++G+ina++alla++aGf+a+YlsG+++aa slg+PDlg+t l++v+++ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3819 9 GQRFRDAVASEHPLQVVGTINANHALLAKRAGFKAIYLSGGGVAAgSLGVPDLGITGLDDVLTD 72 789****************************************999****************** PP TIGR02317 65 arritrvtklpllvDaDtGfGe.alnvartvkeleeagvaavhieDqvapkkCGhldgkelvsk 127 +rrit+v++lpllvD+DtGfG+ a+nvartvk++++ g+aa+hieDqv +k+CGh+++ke+v++ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3819 73 VRRITDVCDLPLLVDVDTGFGSsAFNVARTVKSMIKFGAAAIHIEDQVGAKRCGHRPNKEIVTQ 136 *********************889**************************************** PP TIGR02317 128 eemvkkikaavkakkdedfvliaRtDaraveGldaaieRakaYveaGadaiftealeseeefre 191 +emv++ikaav+a++d++fv++aRtDa aveGl++a++Ra a +eaGad++f+ea++++e+++ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3819 137 QEMVDRIKAAVDARTDDSFVIMARTDALAVEGLESALDRAAACIEAGADMVFPEAITELEMYKL 200 **************************************************************** PP TIGR02317 192 fakavkvpllanmtefGktplltadeleelgykiviyPvtalRaalkaaekvyeelkkkGtqke 255 fa++vk+p+lan+tefG tpl+t+++l+ + +++v+yP++a+Ra++kaae+vy+ ++++Gtq++ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3819 201 FASRVKAPILANITEFGATPLYTTEQLAAADVSLVLYPLSAFRAMNKAAENVYTAIRRDGTQQN 264 **************************************************************** PP TIGR02317 256 lldklqtRkelYellgyedyekkdkelfk 284 ++d++qtR elY+ ++y+++e+k++ lf+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3819 265 VIDTMQTRMELYDRIDYHTFEQKLDALFA 293 ************************99985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (296 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.82 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory