GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PS417_12065 in Pseudomonas fluorescens FW300-N1B4

Align D-ribose transporter ATP-binding protein; SubName: Full=Putative xylitol transport system ATP-binding protein; SubName: Full=Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate Pf1N1B4_6034 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)

Query= uniprot:A0A1N7TX47
         (495 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6034 Ribose ABC transport
           system, ATP-binding protein RbsA (TC 3.A.1.2.1)
          Length = 517

 Score =  312 bits (800), Expect = 2e-89
 Identities = 193/493 (39%), Positives = 279/493 (56%), Gaps = 8/493 (1%)

Query: 6   LLQAEHVAKAYAGVPALRDGRLSLRAGSVHALCGGNGAGKSTFLSILMGITQRDAGSILL 65
           +L    + K YA  P L    L+L  G V AL G NGAGKST   I+ G+     G +  
Sbjct: 9   VLSVSGIGKTYAQ-PVLTGIDLTLMRGEVLALTGENGAGKSTLSKIIGGLVAPTTGQMRF 67

Query: 66  NGAPVQFNRPSEALAAGIAMITQELEPIPYMTVAENIWLGREPRRAGCIVDNKALNRRTR 125
            G   +    S+A   GI M+ QEL  +P ++VAEN++L   P   G I   K L +   
Sbjct: 68  QGRDYRPGSRSQAEELGIRMVMQELNLLPTLSVAENLFLDNLPSHGGWI-SRKQLRKAAI 126

Query: 126 ELLDSLEFD-VDATSPMHRLSVAQIQLVEIAKAFSHDCQVMIMDEPTSAIGEHEAQTLFK 184
           E +  +  D +D  + +  L +   Q+VEIA+    DC V+I+DEPT+ +   E + LF+
Sbjct: 127 EAMAQVGLDAIDPDTLVGELGIGHQQMVEIARNLIGDCHVLILDEPTAMLTAREVEMLFE 186

Query: 185 AIRRLTAQGAGIVYVSHRLSELAQIADDYSIFRDGAFVESGRMADIDRDHLVRGIVGQEL 244
            I RL A+G  I+Y+SHRL ELA++A   ++ RDG  V    MA+ + + LV  +VG+EL
Sbjct: 187 QITRLQARGVSIIYISHRLEELARVAQRIAVLRDGNLVCVEPMANYNSEQLVTLMVGREL 246

Query: 245 -TRIDHKVGRECAANTCLQVDNLSRAGEFHDISLQLRQGEILGIYGLMGSGRSEFLNCIY 303
              ID  +G        L V  L+R+ +  D+S ++R GEI GI GL+G+GR+E L  I+
Sbjct: 247 GEHID--MGPRKIGAPALTVKGLTRSDKVRDVSFEVRAGEIFGISGLIGAGRTELLRLIF 304

Query: 304 GLTVADSGSVTLQGKPMPIGL--PKATINAGMSLVTEDRKDSGLVLTGSILSNIALSAYK 361
           G   ADSG+V L      + +  P   +  G++L+TEDRK  GL+LT SI +NIAL    
Sbjct: 305 GADTADSGTVALGASAQVVSIRSPADAVGHGIALITEDRKGEGLLLTQSISANIALGNMP 364

Query: 362 RLSSWSLINARKETQLAEDMVKRLQIKTTSLELPVASMSGGNQQKVVLAKCLSTEPVCLL 421
            +SS   +N   E  LA+  +  ++I+++S    V+ +SGGNQQKVV+ + L  +   +L
Sbjct: 365 VISSGGFVNNGDEMSLAQRQINAMRIRSSSPTQLVSELSGGNQQKVVIGRWLERDCTVML 424

Query: 422 CDEPTRGIDEGAKQEIYHLLDQFVRGGGAAIVVSSEAPELLHLSDRIAVFKGGRLVTIST 481
            DEPTRGID GAK +IY LL +  R G A +VVSS+  EL+ + DRI V   GRL+    
Sbjct: 425 FDEPTRGIDVGAKFDIYALLGELTRQGKALVVVSSDLRELMLICDRIGVLSAGRLIDTFE 484

Query: 482 DTALSQEALLRLA 494
             + +Q+ LL  A
Sbjct: 485 RDSWTQDDLLAAA 497


Lambda     K      H
   0.319    0.135    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 597
Number of extensions: 27
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 495
Length of database: 517
Length adjustment: 34
Effective length of query: 461
Effective length of database: 483
Effective search space:   222663
Effective search space used:   222663
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory