GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xylK_Tm in Pseudomonas fluorescens FW300-N1B4

Align Ribose import ATP-binding protein RbsA 1; EC 7.5.2.7 (characterized, see rationale)
to candidate Pf1N1B4_1243 ABC transporter ATP-binding protein

Query= uniprot:Q9WXX0
         (520 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1243 ABC transporter
           ATP-binding protein
          Length = 521

 Score =  282 bits (722), Expect = 2e-80
 Identities = 161/491 (32%), Positives = 270/491 (54%), Gaps = 20/491 (4%)

Query: 10  DRMEILKAKGIVKRFPGVVAVDNVDFEVYENEIVSLIGENGAGKSTLIKILTGVLKPDAG 69
           D++  L+ + I KR+PG +A D +D  +   EI +L+GENGAGKSTL+KI+ GV   D+G
Sbjct: 9   DQIPRLQLRRISKRYPGCLANDAIDLSIAPGEIHALLGENGAGKSTLMKIIYGVTHADSG 68

Query: 70  EILVNGERVEFHSPVDAFKKGISVIHQELNLCDNMTVAENIFLAYEAVRGQKRTLSSRVD 129
           E++  G+RV   +P  A   GI ++ Q  +L + ++VA+NI LA  A  G  + L  ++ 
Sbjct: 69  EMIWQGQRVTMRNPAQARGLGIGMVFQHFSLFETLSVAQNIALAMGAAAGTPKQLEPKI- 127

Query: 130 ENYMYTRSKELLDLIGAKFSPDALVRNLTTAQRQMVEICKALVKEPRIIFMDEPTSSLTV 189
                   +E+    G    P+ LV +L+  +RQ VEI + L+++ R++ +DEPTS LT 
Sbjct: 128 --------REVSQRYGMALEPERLVHSLSIGERQRVEIIRCLMQDIRLLILDEPTSVLTP 179

Query: 190 EETERLFEIIEMLKSRGISVVFVSHRLDEVMRISDRIVVMRDGKRIGELKKGEFDVDTII 249
           +E + LF  +  L + G S++F+SH+L EV  +     V+R G+  G     +     + 
Sbjct: 180 QEADELFVTLRRLAAEGCSILFISHKLGEVRALCHSATVLRGGRVAGHCVPAQCSDRQLA 239

Query: 250 KMMVGREVEFFPHGIETRPGEIALEVRNLKWKD------KVKNVSFEVRKGEVLGFAGLV 303
           ++MVG   E      +    +  L V  L W +       +KN+ F+VR GE++G AG+ 
Sbjct: 240 QLMVGEAAELITDYPKVMGADAFLSVTGLSWHNPDPFGCSLKNIDFDVRSGEIVGVAGVA 299

Query: 304 GAGRTETMLLVFG---VNQKESGDIYVNGRKVEIKNPEDAIKMGIGLIPEDRKLQGLVLR 360
           G G+ E + L+ G   + + +S  I   G+ V    P+   K+G+  +P +R   G V  
Sbjct: 300 GNGQDELLALLSGEERLPRDDSATISFGGQPVAHLRPDARRKLGLAFVPAERLGHGAVPE 359

Query: 361 MTVKDNIVLPSLKK-ISRWGLVLDERKEEEISEDYVKRLSIKTPSIYQITENLSGGNQQK 419
           +++ DN +L + ++ +   GLV    K + ++ED ++R  +KTP       +LSGGN QK
Sbjct: 360 LSLADNALLTAFQQGLVSHGLV-QRGKVQALAEDIIRRFGVKTPDSLAPARSLSGGNLQK 418

Query: 420 VVLAKWLATNADILIFDEPTRGIDVGAKAEIHRMIRELAAQGKAVIMISSELPEILNLSD 479
            +L + +     +L+   PT G+DVGA A IHR +  L   G A+++IS +L E+  + D
Sbjct: 419 FILGREILQQPKLLVAAHPTWGVDVGAAATIHRALIALRDAGAAILVISEDLDELFQICD 478

Query: 480 RIVVMWEGEIT 490
           R+  +  G+++
Sbjct: 479 RLGALCGGQLS 489


Lambda     K      H
   0.319    0.138    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 636
Number of extensions: 36
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 520
Length of database: 521
Length adjustment: 35
Effective length of query: 485
Effective length of database: 486
Effective search space:   235710
Effective search space used:   235710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory